Anti-Naca-rs antibody - C-terminal (ab171018)

Overview

  • Product name

    Anti-Naca-rs antibody - C-terminal
  • Description

    Rabbit polyclonal to Naca-rs - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Mouse Naca-rs (C terminal). The exact sequence is proprietary.
    Sequence:

    VMFEERICSESHLGPKAGFRKEKEVNLQELGKVELPPSWFRDLRTKYPVK

  • Positive control

    • Mouse stomach lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab171018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa.

Target

  • Relevance

    Prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. Also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites) By similarity. Isoform 1 and isoform 2 appear to bind DNA and play roles in transcription. May act to regulate the expression of genes involved in the development of myotubes.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Database links

  • Alternative names

    • Naca antibody
    • Alpha-NAC, muscle-specific form antibody
    • Gm1878 antibody
    • Nascent polypeptide-associated complex subunit alpha, muscle-specific form antibody

Images

  • Anti-Naca-rs antibody - C-terminal (ab171018) at 1 µg/ml + Mouse stomach lysate at 10 µg

    Predicted band size: 32 kDa

References

ab171018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Tissue lysate - whole (Heart)
Gel Running Conditions
Reduced Denaturing (4-12%)
Loading amount
20 µg
Specification
Heart
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jan 24 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up