Overview

  • Product name

    Anti-NACA1 antibody
  • Description

    Rabbit polyclonal to NACA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Zebrafish, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human NACA1 aa 132-171.
    Sequence:

    SQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEV


    Database link: Q13765

  • Positive control

    • ICC/IF: SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

 

Target

  • Function

    Prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. Also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites). May act as a specific coactivator for JUN, binding to DNA and stabilizing the interaction of JUN homodimers with target gene promoters.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the NAC-alpha family.
    Contains 1 NAC-A/B (NAC-alpha/beta) domain.
    Contains 1 UBA domain.
  • Post-translational
    modifications

    Phosphorylation of Ser-43 by ILK during cell adhesion may promote nuclear localization. Phosphorylation of Thr-159 by GSK3B may promote proteasome mediated degradation (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus. Predominantly cytoplasmic. Also found in nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha NAC antibody
    • Alpha-NAC antibody
    • Hom s 2.02 antibody
    • HSD48 antibody
    • MGC117224 antibody
    • NAC-alpha antibody
    • naca antibody
    • NACA/1.9.2 antibody
    • NACA_HUMAN antibody
    • NACA1 antibody
    • Nascent polypeptide associated complex alpha polypeptide antibody
    • Nascent polypeptide associated complex alpha subunit antibody
    • Nascent polypeptide associated complex subunit alpha antibody
    • Nascent polypeptide-associated complex subunit alpha antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for NACA1 (green) using ab221950 at 4 µg/ml in ICC/IF. 

References

ab221950 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - other (kidney)
Gel Running Conditions
Reduced Denaturing (15%)
Loading amount
1e+006 cells
Specification
kidney
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jul 06 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up