Overview

  • Product name

  • Description

    Rabbit polyclonal to NADK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human NADK aa 187-426. N-terminal His-tag and GST-tag. (Expressed in E.coli).
    Sequence:

    LLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVL RSRLKVRVVKELRGKKTAVHNGLGENGSQAAGLDMDVGKQAMQYQVLNEV VIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMI HPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRK RQEIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQCLH


    Database link: O95544

  • Positive control

    • WB: Recombinant human NADK, HEK-293T whole cell lysate and pig kidney tissue lysate. IHC-P: Human liver and stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 49 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for NADK using ab233261 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for NADK using ab233261 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-NADK antibody (ab233261) at 2 µg/ml + Recombinant human NADK protein

    Predicted band size: 49 kDa

  • Anti-NADK antibody (ab233261) at 2 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Predicted band size: 49 kDa

  • Anti-NADK antibody (ab233261) at 2 µg/ml + Pig kidney tissue lysate

    Predicted band size: 49 kDa

References

ab233261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up