Overview

  • Product name

  • Description

    Rabbit polyclonal to NADSYN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to Human NADSYN1 aa 655-704 (C terminal).
    Sequence:

    PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG


    Database link: NP_060631

  • Positive control

    • PANC1 whole cell lysate.
  • General notes

     This product was previously labelled as NAD Synthetase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab139561 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 79 kDa.

Target

Images

  • Anti-NADSYN1 antibody (ab139561) at 1 µg/ml + PANC1 whole cell lysate at 10 µg

    Predicted band size: 79 kDa

References

This product has been referenced in:

  • Zhou CC  et al. Hepatic NAD(+) deficiency as a therapeutic target for non-alcoholic fatty liver disease in ageing. Br J Pharmacol 173:2352-68 (2016). Read more (PubMed: 27174364) »
  • Marin TL  et al. Identification of AMP-activated protein kinase targets by a consensus sequence search of the proteome. BMC Syst Biol 9:13 (2015). WB . Read more (PubMed: 25890336) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139561.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up