Overview

  • Product name

  • Description

    Rabbit polyclonal to NAGA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human NAGA aa 18-217. (Expressed in E.coli).
    Sequence:

    LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGW RDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLG IYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQ GYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDD


    Database link: P17050

  • Positive control

    • IHC-P: Human kidney tissue. WB: Rat cerebrum lysate; Human lung lysate; HEK-293T cell lysate; Recombinant human NAGA protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 47 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    NAGA encodes the lysosomal enzyme alpha N acetylgalactosaminidase, which cleaves alpha N acetylgalactosaminyl moieties from glycoconjugates. Mutations in NAGA have been identified as the cause of Schindler disease types I and II (type II also known as Kanzaki disease). Alpha galactosidase B was first found to be an isoenzyme of alpha galactosidases, but apparently it differs from alpha galactosidase A in substrate specificity and is alpha N acetylgalactosaminidase.
  • Cellular localization

    Lysosome
  • Database links

  • Alternative names

    • Acetylgalactosaminidase, alpha N (alpha galactosidase B) antibody
    • Alpha galactosidase B antibody
    • Alpha N acetylgalactosaminidase antibody
    • GALB antibody
    • N acetylgalactosaminidase, alpha antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for NAGA using ab233140 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-NAGA antibody (ab233140) at 2 µg/ml + Recombinant human NAGA protein

    Predicted band size: 47 kDa

  • Anti-NAGA antibody (ab233140) at 2 µg/ml + Rat cerebrum lysate

    Predicted band size: 47 kDa

  • Anti-NAGA antibody (ab233140) at 2 µg/ml + Human lung lysate

    Predicted band size: 47 kDa

  • Anti-NAGA antibody (ab233140) at 2 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Predicted band size: 47 kDa

References

ab233140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up