Overview

  • Product name

  • Description

    Rabbit polyclonal to NAGA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse NAGA aa 18-217. (Expressed in E.coli).
    Sequence:

    LENGLLRTPPMGWLAWERFRCNIDCVEDPKNCISERLFMEMADRLAQDGW RDLGYVYLNIDDCWIGGRDASGRLIPDPKRFPHGIAFLADYAHSLGLKLG IYEDMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSRERAE GYPKMAAALNATGRPIAFSCSWPAYEGGLPPKVNYTEVSRVCNLWRNYKD


    Database link: Q9QWR8

  • Positive control

    • WB: HeLa and MCF7 cell lysate; Mouse liver and testis lysate; Recombinant mouse NADA protein. IHC-P: Mouse pancreas and testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 47 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    NAGA encodes the lysosomal enzyme alpha N acetylgalactosaminidase, which cleaves alpha N acetylgalactosaminyl moieties from glycoconjugates. Mutations in NAGA have been identified as the cause of Schindler disease types I and II (type II also known as Kanzaki disease). Alpha galactosidase B was first found to be an isoenzyme of alpha galactosidases, but apparently it differs from alpha galactosidase A in substrate specificity and is alpha N acetylgalactosaminidase.
  • Cellular localization

    Lysosome
  • Database links

  • Alternative names

    • Acetylgalactosaminidase, alpha N (alpha galactosidase B) antibody
    • Alpha galactosidase B antibody
    • Alpha N acetylgalactosaminidase antibody
    • GALB antibody
    • N acetylgalactosaminidase, alpha antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for NAGA using ab233264 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse pancreas tissue stained for NAGA using ab233264 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-NAGA antibody (ab233264) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 47 kDa

  • Anti-NAGA antibody (ab233264) at 2 µg/ml + Mouse testis lysate

    Predicted band size: 47 kDa

  • Anti-NAGA antibody (ab233264) at 2 µg/ml + Mouse liver lysate

    Predicted band size: 47 kDa

  • Anti-NAGA antibody (ab233264) at 2 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 47 kDa

  • Anti-NAGA antibody (ab233264) at 2 µg/ml + Recombinant mouse NAGA protein

    Predicted band size: 47 kDa

References

ab233264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up