Overview

  • Product name

    Anti-NAIF1 antibody
  • Description

    Rabbit polyclonal to NAIF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Cynomolgus monkey
  • Immunogen

    Fusion protein corresponding to Human NAIF1 aa 1-327. The identity of the protein fusion partner is GST.
    Sequence:

    MAVPAKKRKMNFSEREVEIIVEELELKKHLLVNHFNAGVPLAAKSAAWHG ILRRVNAVATCRRELPEVKKKWSDLKTEVRRKVAQVRAAVEGGEAPGPTE EDGAGGPGTGGGSGGGGPAVAPVLLTPMQQRICNLLGEATIISLPSTTEI HPVALGPSATAAAATVTLTQIPTETTYHTLEEGVVEYCTAEAPPPLPPET PVDMMAQHADTSVKPQALKSRIALNSAKLIQEQRVTNLHVKEIAQHLEQQ NDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYL QSNTANPAPASDPGQVAQNGQPDSIIQ


    Database link: Q69YI7

  • Positive control

    • 293T cell lysate; Human ovarian cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197693 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 35 kDa.
IHC-P 1/50 - 1/200.

Target

Images

  • Anti-NAIF1 antibody (ab197693) at 1/750 dilution + 293T cell lysate at 30 µg

    Predicted band size: 35 kDa


    Exposure time: 1 minute


    12% SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded Human ovarian cancer tissue labeling NAIF1 with ab197693 at 1/60 dilution.

References

ab197693 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197693.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up