Overview

  • Product name

  • Description

    Rabbit polyclonal to Naked1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Naked1 aa 181-254.
    Sequence:

    LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAP LRFQGDSRLEQSGCYHHCVDENIE


    Database link: Q969G9

  • Positive control

    • Human colon tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Naked1 (Nkd1) is a homologue of Drosophila Naked cuticle, a negative regulator of Wnt/Wingless signaling pathway. Naked proteins contain a putative calcium-binding EF-hand motif; however, Drosophila Naked binds to zinc instead of calcium. Naked inhibits the canonical Wnt/ß-catenin pathway by binding to Dishevelled proteins and directs Dishevelled activity towards the planar cell polarity pathway. Naked1 is a direct target of Wnt signaling and is overexpressed in some colon tumors due to constitutive activation of Wnt/ß-catenin pathway.
  • Cellular localization

    Cell membrane
  • Database links

  • Alternative names

    • Dvl-binding protein antibody
    • Naked cuticle 1 antibody
    • naked cuticle 1 homolog antibody
    • Naked cuticle homolog 1 (Drosophila) antibody
    • Naked-1 antibody
    • NKD antibody
    • Nkd1 antibody
    • Protein naked cuticle homolog 1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling Naked1 with ab185082 at 1/50 dilution.

References

ab185082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up