Overview

  • Product name

  • Description

    Rabbit polyclonal to Naked1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Naked1 aa 269-384.
    Sequence:

    TSQFGPGSPSVAQKSELPPRTSNPTRSRSHEPEAIHIPHRKPQGVDPASF HFLDTPIAKVSELQQRLRGTQDGSKHFVRSPKAQGKSVGVGHVARGARNK PPLGPAIPAVSPSAHL


    Database link: Q969G9

  • Positive control

    • ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/200 - 1/500.

Target

  • Relevance

    Naked1 (Nkd1) is a homologue of Drosophila Naked cuticle, a negative regulator of Wnt/Wingless signaling pathway. Naked proteins contain a putative calcium-binding EF-hand motif; however, Drosophila Naked binds to zinc instead of calcium. Naked inhibits the canonical Wnt/ß-catenin pathway by binding to Dishevelled proteins and directs Dishevelled activity towards the planar cell polarity pathway. Naked1 is a direct target of Wnt signaling and is overexpressed in some colon tumors due to constitutive activation of Wnt/ß-catenin pathway.
  • Cellular localization

    Cell membrane
  • Database links

  • Alternative names

    • Dvl-binding protein antibody
    • Naked cuticle 1 antibody
    • naked cuticle 1 homolog antibody
    • Naked cuticle homolog 1 (Drosophila) antibody
    • Naked-1 antibody
    • NKD antibody
    • Nkd1 antibody
    • Protein naked cuticle homolog 1 antibody
    see all

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Naked1 using ab237535 at a dilution of 1/200 in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

References

ab237535 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up