Overview

  • Product name

  • Description

    Rabbit Polyclonal to NAK/TBK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human NAK/TBK1 aa 364-585.
    Sequence:

    GRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDAS MAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTE VVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQG TIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIY YQFKKDKAERRLAYNEEQIHKF


    Database link: Q9UHD2

  • Positive control

    • WB: Mouse liver and brain lysates. IHC-P: Human testis tissue. ICC/IF: HeLa (human epithelial cell line from cervix adenocarcinoma) cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
WB 1/2000 - 1/5000. Detects a band of approximately 84 kDa (predicted molecular weight: 84 kDa).

Target

  • Function

    Serine/threonine protein involved in the signaling cascade converging to the activation of the transcription factor NF-kappa-B. May function as an IKK kinase, playing an essential role in the transcription of a subset of TNF-alpha-induced genes. Also mediates production of RANTES/CCL5 and interferon-beta/IFNB1. Has a pivotal role in the innate immune response. Phosphorylates Borna disease virus (BDV) P protein. Phosphorylates and activates IRF3 and IRF7 and allows their nuclear localization. This leads to production of alpha/beta interferons and the development of a cellular antiviral state. It also seems to be a central factor in the induction of the antiviral interferon response. Inhibition of its interaction with IRF3, due to HCV NS3 binding or BDV P protein seems to be one mechanism of inhibition of the innate immune responses of hepatitis C virus (HCV) infection or Borna disease virus infection respectively.
  • Tissue specificity

    Ubiquitous with higher expression in testis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. I-kappa-B kinase subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.7.11.1 antibody
    • FLJ11330 antibody
    • FTDALS4 antibody
    • NAK antibody
    • NF kappa B activating kinase antibody
    • NF kB activating kinase antibody
    • NF-kappa-B-activating kinase antibody
    • Serine/threonine protein kinase TBK 1 antibody
    • Serine/threonine protein kinase TBK1 antibody
    • Serine/threonine-protein kinase TBK1 antibody
    • T2K antibody
    • TANK binding kinase 1 antibody
    • TANK-binding kinase 1 antibody
    • TBK 1 antibody
    • Tbk1 antibody
    • TBK1_HUMAN antibody
    see all

Images

  • All lanes : Anti-NAK/TBK1 antibody (ab222809) at 1/2000 dilution

    Lane 1 : Mouse liver lysate
    Lane 2 : Mouse brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 84 kDa
    Observed band size: 84 kDa

  • Paraffin-embedded human testis tissue stained for NAK/TBK1 using ab222809 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NAK/TBK1 (green) using ab222809 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab222809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up