Anti-NALP4 antibody (ab204111)
Key features and details
- Rabbit polyclonal to NALP4
- Suitable for: IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-NALP4 antibody -
Description
Rabbit polyclonal to NALP4 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Synthetic peptide within Human NALP4 aa 370-420 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:SVYSSFVFNLFTPEGAEGPTPQTQHQLKALCSLAAEGMWTDTFEFCEDDL R
Database link: Q96MN2 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab204111 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. When using a fluorescent probe the recommended dilution is 1/50-1/200. |
Target
-
Function
May be involved in inflammation. -
Sequence similarities
Belongs to the NLRP family.
Contains 1 DAPIN domain.
Contains 8 LRR (leucine-rich) repeats.
Contains 1 NACHT domain. - Information by UniProt
-
Database links
- Entrez Gene: 147945 Human
- Entrez Gene: 499069 Rat
- Omim: 609645 Human
- SwissProt: Q96MN2 Human
- Unigene: 631533 Human
- Unigene: 222403 Rat
-
Alternative names
- Cancer/testis antigen 58 antibody
- CLR19.5 antibody
- CT58 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NALP4 antibody (ab204111)Immunohistochemistry analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling NALP4 with ab204111 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NALP4 antibody (ab204111)Immunohistochemistry analysis of formalin-fixed, paraffin-embedded Human lung carcinoma tissue labeling NALP4 with ab204111 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NALP4 antibody (ab204111)Immunohistochemistry analysis of formalin-fixed, paraffin-embedded rat colitis tissue labeling NALP4 with ab204111 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Datasheets and documents
References (0)
ab204111 has not yet been referenced specifically in any publications.
