Overview

  • Product name

  • Description

    Rabbit polyclonal to NALP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human NALP4 aa 370-420 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    SVYSSFVFNLFTPEGAEGPTPQTQHQLKALCSLAAEGMWTDTFEFCEDDL R


    Database link: Q96MN2

  • Positive control

    • Human colon carcinoma tissue; Human lung carcinoma tissue; rat colitis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 113 kDa.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50-1/200.

Target

  • Function

    May be involved in inflammation.
  • Sequence similarities

    Belongs to the NLRP family.
    Contains 1 DAPIN domain.
    Contains 8 LRR (leucine-rich) repeats.
    Contains 1 NACHT domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 58 antibody
    • CLR19.5 antibody
    • CT58 antibody
    • FLJ32126 antibody
    • NACHT, leucine rich repeat and PYD containing 4 antibody
    • NACHT, LRR and PYD containing protein 4 antibody
    • NACHT, LRR and PYD domains-containing protein 4 antibody
    • NALP4_HUMAN antibody
    • NLR family, pyrin domain containing 4 antibody
    • NLRP4 antibody
    • Nucleotide binding oligomerization domain, leucine rich repeat and pyrin domain containing 4 antibody
    • PAAD and NACHT containing protein 2 antibody
    • PAAD and NACHT-containing protein 2 antibody
    • PAN2 antibody
    • PYPAF4 antibody
    • PYRIN and NACHT-containing protein 2 antibody
    • PYRIN containing APAF1 like protein 4 antibody
    • PYRIN-containing APAF1-like protein 4 antibody
    • Ribonuclease inhibitor 2 antibody
    • RNH2 antibody
    see all

Images

  • Immunohistochemistry analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling NALP4 with ab204111 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining

  • Immunohistochemistry analysis of formalin-fixed, paraffin-embedded Human lung carcinoma tissue labeling NALP4 with ab204111 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemistry analysis of formalin-fixed, paraffin-embedded rat colitis tissue labeling NALP4 with ab204111 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab204111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up