Anti-NALP4 antibody (ab204111)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-NALP4 antibody
See all NALP4 primary antibodies -
Description
Rabbit polyclonal to NALP4 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Synthetic peptide within Human NALP4 aa 370-420 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:SVYSSFVFNLFTPEGAEGPTPQTQHQLKALCSLAAEGMWTDTFEFCEDDL R
Database link: Q96MN2 -
Positive control
- Human colon carcinoma tissue; Human lung carcinoma tissue; rat colitis tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab204111 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/100 - 1/1000. Predicted molecular weight: 113 kDa. | |
IHC-P | 1/100 - 1/500. When using a fluorescent probe the recommended dilution is 1/50-1/200. |
Target
-
Function
May be involved in inflammation. -
Sequence similarities
Belongs to the NLRP family.
Contains 1 DAPIN domain.
Contains 8 LRR (leucine-rich) repeats.
Contains 1 NACHT domain. - Information by UniProt
-
Database links
- Entrez Gene: 147945 Human
- Entrez Gene: 499069 Rat
- Omim: 609645 Human
- SwissProt: Q96MN2 Human
- Unigene: 631533 Human
- Unigene: 222403 Rat
-
Alternative names
- Cancer/testis antigen 58 antibody
- CLR19.5 antibody
- CT58 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NALP4 antibody (ab204111)
Immunohistochemistry analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling NALP4 with ab204111 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NALP4 antibody (ab204111)
Immunohistochemistry analysis of formalin-fixed, paraffin-embedded Human lung carcinoma tissue labeling NALP4 with ab204111 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NALP4 antibody (ab204111)
Immunohistochemistry analysis of formalin-fixed, paraffin-embedded rat colitis tissue labeling NALP4 with ab204111 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Datasheets and documents
References
ab204111 has not yet been referenced specifically in any publications.