Overview

  • Product name

  • Description

    Rabbit polyclonal to NANS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NANS aa 132-259.
    Sequence:

    VGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCF LQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALG AKVLERHITLDKTWKGSDHSASLEPGEL


    Database link: Q9NR45

  • Positive control

    • IHC-P: Human adrenal gland and gastric cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Produces N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN). Can also use N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 AFP-like domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.5.1.56 antibody
    • EC 2.5.1.57 antibody
    • N acetylneuraminate 9 phosphate synthase antibody
    • N acetylneuraminate synthase antibody
    • N acetylneuraminic acid phosphate synthase antibody
    • N acetylneuraminic acid synthase antibody
    • N-acetylneuraminate synthase antibody
    • N-acetylneuraminate-9-phosphate synthase antibody
    • N-acetylneuraminic acid phosphate synthase antibody
    • N-acetylneuraminic acid synthase antibody
    • NANS antibody
    • OTTHUMP00000021769 antibody
    • SAS antibody
    • Sialic acid phosphate synthase antibody
    • Sialic acid synthase antibody
    • SIAS_HUMAN antibody
    see all

Images

  • Paraffin-embedded human gastric cancer tissue stained for NANS using ab236783 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for NANS (green) using ab236783 at 1/66 dilution in ICC/IF, followed by an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody. Counterstained with DAPI. The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C. 

  • Paraffin-embedded human adrenal gland tissue stained for NANS using ab236783 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab236783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up