Overview

  • Product name

    Anti-NAPA antibody
  • Description

    Rabbit polyclonal to NAPA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment within Human NAPA aa 25-295. The exact sequence is proprietary.
    Sequence:

    QSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQ LQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHH ISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAAL LEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLA VQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQ WLTTMLLRIKKTIQGDEEDLR


    Database link: P54920

  • Positive control

    • HeLa, Jurkat, Human liver cancer tissue and Mouse brain tissue lysates; Human liver cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.05% Sodium azide
    Constituents: 50% Glycerol, 49% PBS

    PBS without Mg2+ and Ca2+
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 33 kDa.
ELISA 1/2000 - 1/5000.
IHC-P 1/25 - 1/100.

Target

Images

  • All lanes : Anti-NAPA antibody (ab182781) at 1/350 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : Jurkat cell lysate
    Lane 3 : Human liver cancer tissue lysate
    Lane 4 : Mouse brain tissue lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    All lanes : Goat anti Rabbit IgG - H&L (HRP) at 1/10000 dilution

    Predicted band size: 33 kDa


    Exposure time: 3 seconds
  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling NAPA with ab182781 at 1/25 dilution. The image on the right was treated with the immunogen.

References

ab182781 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up