Overview

  • Product name

  • Description

    Rabbit polyclonal to NAPE-PLD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NAPE-PLD aa 103-196.
    Sequence:

    ELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSS RASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSV


    Database link: Q6IQ20

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: A431 cells. WB: Human liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab246951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml.

Target

  • Function

    Hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. Responsible for the generation of anandamide (N-arachidonoylethanolamine), the ligand of cannabinoid and vanilloid receptors.
  • Sequence similarities

    Belongs to the NAPE-PLD family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C7orf18 antibody
    • DKFZp781D1098 antibody
    • FMP30 antibody
    • Mbldc1 antibody
    • N acyl phosphatidylethanolamine hydrolyzing phospholipase D antibody
    • N acyl phosphatidylethanolamine phospholipase D antibody
    • N-acyl phosphatidylethanolamine phospholipase D antibody
    • N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D antibody
    • NAPE hydrolyzing phospholipase D antibody
    • NAPE-hydrolyzing phospholipase D antibody
    • NAPE-PLD antibody
    • NAPEP_HUMAN antibody
    • NAPEPLD antibody
    see all

Images

  • FA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling NAPE-PLD using ab246951 at 4 µg/ml (green) in ICC/IF.

  • Paraffin-embedded human kidney tissue stained for NAPE-PLD using ab246951 at 1/50 dilution in immunohistochemical analysis.
  • All lanes : Anti-NAPE-PLD antibody (ab246951) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue lysate

References

ab246951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up