Overview

  • Product name

    Anti-NAPRT1 antibody [CL0366]
    See all NAPRT1 primary antibodies
  • Description

    Mouse monoclonal [CL0366] to NAPRT1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human NAPRT1 aa 286-382.
    Sequence:

    LLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVF RAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSV


    Database link: Q6XQN6

  • Epitope

    epitope located within the peptide sequence IRKVFRAAAA (aa 331-340)
  • Positive control

    • Human liver lysate; Human kidney, duodenum, placenta, testis and fallopian tube tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab212028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 58 kDa.

Target

  • Function

    Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.
  • Pathway

    Cofactor biosynthesis; NAD(+) biosynthesis; nicotinate D-ribonucleotide from nicotinate: step 1/1.
  • Sequence similarities

    Belongs to the NAPRTase family.
  • Cellular localization

    Cytoplasm > cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • FHA HIT interacting protein antibody
    • FHA-HIT-interacting protein antibody
    • FHIP antibody
    • NAPRT1 antibody
    • NAPRTase antibody
    • Nicotinate phosphoribosyltransferase antibody
    • Nicotinate phosphoribosyltransferase domain containing 1 antibody
    • Nicotinate phosphoribosyltransferase domain-containing protein 1 antibody
    • Nicotinic acid phosphoribosyltransferase antibody
    • PNCB_HUMAN antibody
    • PP3856 antibody
    see all

Images

  • Immunohistochemical analysis of Human kidney tissue labeling NAPRT1 with ab212028 at 1/200 dilution.

  • Anti-NAPRT1 antibody [CL0366] (ab212028) at 1/500 dilution + Human liver lysate

    Predicted band size: 58 kDa

  • Immunohistochemical analysis of Human duodenum tissue labeling NAPRT1 with ab212028 at 1/200 dilution.

  • Immunohistochemical analysis of Human placenta tissue labeling NAPRT1 with ab212028 at 1/200 dilution.

  • Immunohistochemical analysis of Human testis tissue labeling NAPRT1 with ab212028 at 1/200 dilution.

  • Immunohistochemical analysis of Human fallopian tube tissue labeling NAPRT1 with ab212028 at 1/200 dilution.

References

ab212028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up