Overview

  • Product name
    Anti-NAPSIN A antibody [10C4B8]
    See all NAPSIN A primary antibodies
  • Description
    Mouse monoclonal [10C4B8] to NAPSIN A
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NAPSIN A aa 20-158.
    Sequence:

    EPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPSPGDKPIFVP LSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLH HRFDPKASSSFQANGTKFAI QYGTGRVDGILSEDKLTIG


    Database link: O96009

  • Positive control
    • NAPSIN A recombinant protein; NAPSIN A transfected HEK293 cell lysate; Rat liver tissue lysate; Rectum cancer tissues; Liver cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab175426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 45 kDa.

Target

  • Function
    May be involved in processing of pneumocyte surfactant precursors.
  • Tissue specificity
    Expressed predominantly in adult lung (type II pneumocytes) and kidney and in fetal lung. Low levels in adult spleen and very low levels in peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the peptidase A1 family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Asp 4 antibody
    • ASP4 antibody
    • Aspartyl protease 4 antibody
    • KAP antibody
    • Kdap antibody
    • Kidney derived aspartic protease like protein antibody
    • NAP1 antibody
    • NAPA antibody
    • Napsa antibody
    • NAPSA_HUMAN antibody
    • Napsin 1 antibody
    • napsin A aspartic peptidase antibody
    • Napsin A precursor antibody
    • Napsin-1 antibody
    • Napsin-A antibody
    • Pronapsin A antibody
    • SNAPA antibody
    • TA01/TA02 antibody
    see all

Images

  • All lanes : Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : NAPSIN A (AA: 20-158)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 45 kDa

  • Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + NAPSIN recombinant protein

    Predicted band size: 45 kDa

  • Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + Rat liver tissue lysate

    Predicted band size: 45 kDa

  • Immunohistochemical analysis of paraffin-embedded liver cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution with DAB staining.

  • Immunohistochemical analysis of paraffin-embedded rectum cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution, with DAB staining.

References

ab175426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up