Anti-NAPSIN A antibody [10C4B8] (ab175426)

Product name

Anti-NAPSIN A antibody [10C4B8]
See all NAPSIN A primary antibodies
Description

Mouse monoclonal [10C4B8] to NAPSIN A
Host species

Mouse
Tested applications

Suitable for: IHC-P, WBmore details
Species reactivity

Reacts with: Rat, Human
Immunogen

Recombinant fragment corresponding to Human NAPSIN A aa 20-158.
Sequence:
EPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPSPGDKPIFVP LSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLH HRFDPKASSSFQANGTKFAI QYGTGRVDGILSEDKLTIG

Database link: O96009

Run BLAST with Run BLAST with
Positive control
- NAPSIN A recombinant protein; NAPSIN A transfected HEK293 cell lysate; Rat liver tissue lysate; Rectum cancer tissues; Liver cancer tissues.

Form

Liquid
Storage instructions

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Storage buffer

Preservative: 0.05% Sodium azide
Constituent: 99% PBS

0.5% protein stabilizer
Concentration information loading...
Purity

Protein G purified
Purification notes

Purified from tissue culture supernatant.
Clonality

Monoclonal
Clone number

10C4B8
Isotype

IgG1
Research areas

Our Abpromise guarantee covers the use of ab175426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application	Abreviews	Notes
IHC-P		1/200 - 1/1000.
WB		1/500 - 1/2000. Predicted molecular weight: 45 kDa.

Function

May be involved in processing of pneumocyte surfactant precursors.
Tissue specificity

Expressed predominantly in adult lung (type II pneumocytes) and kidney and in fetal lung. Low levels in adult spleen and very low levels in peripheral blood leukocytes.
Sequence similarities

Belongs to the peptidase A1 family.
Cellular localization

Secreted.
Target information above from: UniProt accession O96009 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
Database links
- Entrez Gene: 9476 Human
- Entrez Gene: 60575 Rat
- Omim: 605631 Human
- SwissProt: O96009 Human
- Unigene: 512843 Human
Alternative names
- Asp 4 antibody
- ASP4 antibody
- Aspartyl protease 4 antibody
- KAP antibody
- Kdap antibody
- Kidney derived aspartic protease like protein antibody
- NAP1 antibody
- NAPA antibody
- Napsa antibody
- NAPSA_HUMAN antibody
- Napsin 1 antibody
- napsin A aspartic peptidase antibody
- Napsin A precursor antibody
- Napsin-1 antibody
- Napsin-A antibody
- Pronapsin A antibody
- SNAPA antibody
- TA01/TA02 antibody
see all

Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)

All lanes : Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution

Lane 1 : HEK293 cell lysate
Lane 2 : NAPSIN A (AA: 20-158)-hIgGFc transfected HEK293 cell lysate

Predicted band size: 45 kDa
Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)

Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + NAPSIN recombinant protein

Predicted band size: 45 kDa
Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)

Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + Rat liver tissue lysate

Predicted band size: 45 kDa
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)

Immunohistochemical analysis of paraffin-embedded liver cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution with DAB staining.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)

Immunohistochemical analysis of paraffin-embedded rectum cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution, with DAB staining.

ab175426 has not yet been referenced specifically in any publications.

Publishing research using ab175426? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As