Anti-NAPSIN A antibody [10C4B8] (ab175426)

Submit a review Submit a question

Key features and details

  • Mouse monoclonal [10C4B8] to NAPSIN A
  • Suitable for: IHC-P, WB
  • Reacts with: Rat, Human, Recombinant fragment
  • Isotype: IgG1

Overview

  • Product name

    Anti-NAPSIN A antibody [10C4B8]
    See all NAPSIN A primary antibodies

  • Description

    Mouse monoclonal [10C4B8] to NAPSIN A

  • Host species

    Mouse

  • Tested applications

    Suitable for: IHC-P, WBmore details

  • Species reactivity

    Reacts with: Rat, Human, Recombinant fragment

  • Immunogen

    Recombinant fragment corresponding to Human NAPSIN A aa 20-158.
    Sequence:

    EPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPSPGDKPIFVP LSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLH HRFDPKASSSFQANGTKFAI QYGTGRVDGILSEDKLTIG


    Database link: O96009

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • NAPSIN A recombinant protein; NAPSIN A transfected HEK293 cell lysate; Rat liver tissue lysate; Rectum cancer tissues; Liver cancer tissues.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab175426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 45 kDa.

Target

  • Function

    May be involved in processing of pneumocyte surfactant precursors.

  • Tissue specificity

    Expressed predominantly in adult lung (type II pneumocytes) and kidney and in fetal lung. Low levels in adult spleen and very low levels in peripheral blood leukocytes.

  • Sequence similarities

    Belongs to the peptidase A1 family.

  • Cellular localization

    Secreted.
  • Information by UniProt

  • Database links

    • Alternative names

      • Asp 4 antibody
      • ASP4 antibody
      • Aspartyl protease 4 antibody
      • KAP antibody
      • Kdap antibody
      • Kidney derived aspartic protease like protein antibody
      • NAP1 antibody
      • NAPA antibody
      • Napsa antibody
      • NAPSA_HUMAN antibody
      • Napsin 1 antibody
      • napsin A aspartic peptidase antibody
      • Napsin A precursor antibody
      • Napsin-1 antibody
      • Napsin-A antibody
      • Pronapsin A antibody
      • SNAPA antibody
      • TA01/TA02 antibody
      see all

    Images

    • Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
      Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
      All lanes : Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution

      Lane 1 : HEK293 cell lysate
      Lane 2 : NAPSIN A (AA: 20-158)-hIgGFc transfected HEK293 cell lysate

      Predicted band size: 45 kDa

    • Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
      Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
      Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + NAPSIN recombinant protein

      Predicted band size: 45 kDa

    • Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
      Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
      Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + Rat liver tissue lysate

      Predicted band size: 45 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)

      Immunohistochemical analysis of paraffin-embedded liver cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution with DAB staining.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)

      Immunohistochemical analysis of paraffin-embedded rectum cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution, with DAB staining.

    References (0)

    Publishing research using ab175426? Please let us know so that we can cite the reference in this datasheet.

    ab175426 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab175426.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com