Anti-NAPSIN A antibody [10C4B8] (ab175426)
- Datasheet
- References
- Protocols
Overview
-
Product nameAnti-NAPSIN A antibody [10C4B8]
See all NAPSIN A primary antibodies -
DescriptionMouse monoclonal [10C4B8] to NAPSIN A
-
Host speciesMouse
-
Tested applicationsSuitable for: IHC-P, WBmore details
-
Species reactivityReacts with: Rat, Human
-
Immunogen
Recombinant fragment corresponding to Human NAPSIN A aa 20-158.
Sequence:EPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPSPGDKPIFVP LSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLH HRFDPKASSSFQANGTKFAI QYGTGRVDGILSEDKLTIG
Database link: O96009 -
Positive control
- NAPSIN A recombinant protein; NAPSIN A transfected HEK293 cell lysate; Rat liver tissue lysate; Rectum cancer tissues; Liver cancer tissues.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
-
Storage bufferPreservative: 0.05% Sodium azide
Constituent: 99% PBS
0.5% protein stabilizer -
Concentration information loading...
-
PurityProtein G purified
-
Purification notesPurified from tissue culture supernatant.
-
ClonalityMonoclonal
-
Clone number10C4B8
-
IsotypeIgG1
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab175426 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/1000. | |
WB | 1/500 - 1/2000. Predicted molecular weight: 45 kDa. |
Target
-
FunctionMay be involved in processing of pneumocyte surfactant precursors.
-
Tissue specificityExpressed predominantly in adult lung (type II pneumocytes) and kidney and in fetal lung. Low levels in adult spleen and very low levels in peripheral blood leukocytes.
-
Sequence similaritiesBelongs to the peptidase A1 family.
-
Cellular localizationSecreted.
- Information by UniProt
-
Database links
- Entrez Gene: 9476 Human
- Entrez Gene: 60575 Rat
- Omim: 605631 Human
- SwissProt: O96009 Human
- Unigene: 512843 Human
-
Alternative names
- Asp 4 antibody
- ASP4 antibody
- Aspartyl protease 4 antibody
see all
Images
-
All lanes : Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : NAPSIN A (AA: 20-158)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 45 kDa -
Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + NAPSIN recombinant protein
Predicted band size: 45 kDa -
Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + Rat liver tissue lysate
Predicted band size: 45 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)
Immunohistochemical analysis of paraffin-embedded liver cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution with DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)
Immunohistochemical analysis of paraffin-embedded rectum cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution, with DAB staining.
Datasheets and documents
References
ab175426 has not yet been referenced specifically in any publications.