Anti-NAT10 antibody (ab235048)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-NAT10 antibody
See all NAT10 primary antibodies -
Description
Rabbit polyclonal to NAT10 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human NAT10 aa 909-1025.
Sequence:VQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSM DLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKL KNRETKNKKDMKLKRKK
Database link: Q9H0A0 -
Positive control
- WB: HeLa cell lysate. IHC-P: Human pancreatic cancer and brain tissue.
-
General notes
This product was previously labelled as ALP.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.03% Proclin
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
>95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235048 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. | |
IHC-P | 1/200 - 1/500. |
Target
-
Function
Has protein acetyltransferase activity in vitro. Can acetylate both histones and microtubules. Histone acetylation may regulate transcription and mitotic chromosome de-condensation. Activates telomerase activity by stimulating the transcription of TERT, and may also regulate telomerase function by affecting the balance of telomerase subunit assembly, disassembly, and localization. Acetylates alpha-tubulin, which may affect microtubule stability and cell division. -
Sequence similarities
Belongs to the UPF0202 family.
Contains 1 N-acetyltransferase domain. -
Cellular localization
Nucleus > nucleolus. Nucleolar in interphase and redistributes to the perichromosomal layer and to the midbody during telophase. - Information by UniProt
-
Database links
- Entrez Gene: 55226 Human
- Omim: 609221 Human
- SwissProt: Q9H0A0 Human
- Unigene: 577281 Human
-
Alternative names
- ALP antibody
- DKFZp434C116 antibody
- FLJ10774 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAT10 antibody (ab235048)
Paraffin-embedded human brain tissue stained for NAT10 using ab235048 at 1/300 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.
-
Anti-NAT10 antibody (ab235048) at 1/500 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/50000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAT10 antibody (ab235048)
Paraffin-embedded human pancreatic cancer tissue stained for NAT10 using ab235048 at 1/300 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.
References
ab235048 has not yet been referenced specifically in any publications.