Anti-NAT10 antibody (ab235048)
Key features and details
- Rabbit polyclonal to NAT10
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-NAT10 antibody
See all NAT10 primary antibodies -
Description
Rabbit polyclonal to NAT10 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human NAT10 aa 909-1025.
Sequence:VQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSM DLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKL KNRETKNKKDMKLKRKK
Database link: Q9H0A0 -
Positive control
- WB: HeLa cell lysate. IHC-P: Human pancreatic cancer and brain tissue.
-
General notes
This product was previously labelled as ALP.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
>95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235048 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/5000. | |
| IHC-P | 1/200 - 1/500. |
Target
-
Function
Has protein acetyltransferase activity in vitro. Can acetylate both histones and microtubules. Histone acetylation may regulate transcription and mitotic chromosome de-condensation. Activates telomerase activity by stimulating the transcription of TERT, and may also regulate telomerase function by affecting the balance of telomerase subunit assembly, disassembly, and localization. Acetylates alpha-tubulin, which may affect microtubule stability and cell division. -
Sequence similarities
Belongs to the UPF0202 family.
Contains 1 N-acetyltransferase domain. -
Cellular localization
Nucleus > nucleolus. Nucleolar in interphase and redistributes to the perichromosomal layer and to the midbody during telophase. - Information by UniProt
-
Database links
- Entrez Gene: 55226 Human
- Omim: 609221 Human
- SwissProt: Q9H0A0 Human
- Unigene: 577281 Human
-
Alternative names
- ac4C enzyme antibody
- ac4C writer antibody
- DKFZp434C116 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAT10 antibody (ab235048)Paraffin-embedded human brain tissue stained for NAT10 using ab235048 at 1/300 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.
-
Western blot - Anti-NAT10 antibody (ab235048)Anti-NAT10 antibody (ab235048) at 1/500 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/50000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAT10 antibody (ab235048)Paraffin-embedded human pancreatic cancer tissue stained for NAT10 using ab235048 at 1/300 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235048 has not yet been referenced specifically in any publications.
