Overview

  • Product name

  • Description

    Rabbit polyclonal to NAT10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NAT10 aa 909-1025.
    Sequence:

    VQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSM DLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKL KNRETKNKKDMKLKRKK


    Database link: Q9H0A0

  • Positive control

    • WB: HeLa cell lysate. IHC-P: Human pancreatic cancer and brain tissue.
  • General notes

     This product was previously labelled as ALP.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/200 - 1/500.

Target

  • Function

    Has protein acetyltransferase activity in vitro. Can acetylate both histones and microtubules. Histone acetylation may regulate transcription and mitotic chromosome de-condensation. Activates telomerase activity by stimulating the transcription of TERT, and may also regulate telomerase function by affecting the balance of telomerase subunit assembly, disassembly, and localization. Acetylates alpha-tubulin, which may affect microtubule stability and cell division.
  • Sequence similarities

    Belongs to the UPF0202 family.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization

    Nucleus > nucleolus. Nucleolar in interphase and redistributes to the perichromosomal layer and to the midbody during telophase.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALP antibody
    • DKFZp434C116 antibody
    • FLJ10774 antibody
    • FLJ12179 antibody
    • FLJ23850 antibody
    • hALP antibody
    • KIAA1709 antibody
    • N acetyltransferase 10 antibody
    • N acetyltransferase 10 GCN5 related antibody
    • N acetyltransferase like antibody
    • N acetyltransferase like protein antibody
    • N-acetyltransferase 10 antibody
    • NAT10 antibody
    • NAT10_HUMAN antibody
    • NET43 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for NAT10 using ab235048 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

  • Anti-NAT10 antibody (ab235048) at 1/500 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human pancreatic cancer tissue stained for NAT10 using ab235048 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

References

ab235048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up