Overview

  • Product name

  • Description

    Rabbit polyclonal to NAT2/AT-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Hamster
  • Immunogen

    Recombinant fragment corresponding to Rat NAT2/AT-2 aa 20-280. Two N-terminal tags, His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    DLEELTEILQHQIRAIPFENLNIHCGESMELNLEVIFDQVVRKKRGGWCL QVNHLLYWALTKMGFEATMLGGYVFNTPANKYSSGMIHLLVQVTLSGKDY IVDAGFGRSYQMWEPLELTSGKDQPQVPAIFRLTEENGTWYLDQIRREQY VPNQEFVNSDLLEKNKYRKIYSFTLEPRTIEDFESINTYLQTSPASLFTS KSFCSLQTLEGVHCLVGSTLTYRRFSYKDNIDLVEFKSLTEEEIEDVLKT IFGVSLERKLV


    Database link: P50298

  • Positive control

    • IHC-P: Rat heart tissue. WB: Recombinant rat NAT2/AT-2 protein; Mouse liver lysate; Rat serum.
  • General notes

     This product was previously labelled as NAT2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 34 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
  • Sequence similarities

    Belongs to the arylamine N-acetyltransferase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • AAC2 antibody
    • ARY2_HUMAN antibody
    • Arylamide acetylase 2 (N-acetyltransferase 2, isoniazid inactivation) antibody
    • Arylamide acetylase 2 antibody
    • Arylamine N-acetyltransferase 2 antibody
    • HGNC:7646 antibody
    • N-acetyltransferase 2 (arylamine N-acetyltransferase) antibody
    • N-acetyltransferase type 2 antibody
    • NAT-2 antibody
    • NAT2 antibody
    • PNAT antibody
    • Polymorphic arylamine N-acetyltransferase antibody
    see all

Images

  • Anti-GKN2 antibody (ab232821) at 2 µg/ml + Rat serum.

    Predicted band size: 34 kDa

  • Anti-NAT2/AT-2 antibody (ab232822) at 2 µg/ml + Mouse liver tissue lysate.

    Predicted band size: 34 kDa

  • Anti-NAT2/AT-2 antibody (ab232822) at 2 µg/ml + Recombinant rat NAT2/AT-2 protein.

    Predicted band size: 34 kDa

  • Formalin-fixed, paraffin-embedded rat heart tissue stained for NAT2/AT-2 using ab232822 at 20µg/mL in immunohistochemical analysis. DAB staining.

References

ab232822 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up