Overview

  • Product name

    Native Bacillus thuringiensis CRY1Ab Toxin protein
  • Protein length

    Full length protein

Description

  • Nature

    Native
  • Source

    Native
  • Amino Acid Sequence
    • Accession
    • Species

      Bacillus thuringiensis
    • Sequence

      MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEF VPGAGFVLGLVDIIWGIFGPSQWDAFLVQIEQLINQRIEEFARNQAISRL EGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAV QNYQVPLLSVYVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLI GNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTVLDIVSLFPNY DSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDIL NSITIYTDAHRGEYYWSGHQIMASPVGFSGPEFTFPLYGTMGNAAPQQRI VAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRA PMFSWIHRSAEFNNIIPSSQITQIPLTKSTNLGSGTSVVKGPGFTGGDIL RRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGN FSATMSSGSNLQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYID RIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVTDYHIDQVSN LVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGW RGSTDITIQGGDDVFKENYVTLLGTFDECYPTYLYQKIDESKLKAYTRYQ LRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEAL ARVKRAEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDRLQADTNI AMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARN VIKNGDFNNGLSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPG RGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEVYPNNTVTCN DYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDN PCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVEL LLMEE
    • Molecular weight

      131 kDa
    • Amino acids

      1 to 1155
    • Additional sequence information

      Isolated from Bacillus thuringiensis spores.

Specifications

Our Abpromise guarantee covers the use of ab218541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: Tris, 0.1% BSA

General Info

  • Alternative names

    • 130 kDa crystal protein
    • bt2
    • cry 1 2
    • cry1A(b)
    • cryIA(b)
    • cryIC1
    • Crystaline entomocidal protoxin
    • Insecticidal delta endotoxin CryIA(b)
    • Pesticidal crystal protein cry1Ab
    see all
  • Relevance

    CRY1A belongs to the delta endotoxin family and is one of the most studied insecticidal proteins produced by Bacillus thuringiensis. The crystal protein is produced during sporulation and is accumulated both as an inclusion and as part of the spore coat. The toxic segment of the protein is located in the N-terminus. Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

References

ab218541 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up