Description

  • Product name

    Native Cow 19S Proteasome protein
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Native
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Species

      Cow
    • Sequence

      MEFVKCLGHPEEFYNLLRFQMGGRRKVIPKMDQDSLSSSLKTCYKYLNQT SRSFAAVIQALDGEMRHAVCIFYLVLRALDTLEDDMTISIERKVPLLHNF HSYLYEPDWRFTESKEKDRQ VLEDFPTISLEFRNLAEKYQTVIVDVCQ KMGFGMAEFLDKRVTSEREWDKYCHYVAGLVGIGLSRLFPASELEDPLIG EDTERANSMGLFLQKTNIIRDYLEDQREGREFWPQETWSKYVKKLGDFAK PENIDLAVQCLNELITNTLHHIPDVITYLSRLRNQSIFNFCAIPQVMAIA TLAACYNNQQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIHQYMEEIYHR IPNSDPCSTKTQQIISTIRTQNLPNCQLVSRSHYSPIYLSFVMLLAALSW QYLSTLSQVTEDYVQTGEH
    • Predicted molecular weight

      900 kDa
    • Amino acids

      1 to 417
    • Additional sequence information

      Purified from bovine red blood cells.

Specifications

Our Abpromise guarantee covers the use of ab218004 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 0.12% Sodium chloride, 0.03% EDTA, 0.04% Beta mercaptoethanol, 10% Glycerol

General Info

  • Alternative names

    • PA700
  • Relevance

    Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signalling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Others are degraded via the vacuolar pathway which includes endosomes, lysosomes and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. An enzymatic cascade is responsible for the attachment of multiple ubiquitin molecules to lysine residues of proteins targeted for degradation. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis, Angelman’s syndrome and Liddle syndrome.

Images

  • Activation of 5 nM ab218004 by 25 nM PA700, the proteasome activity was assayed by using 50 µM Suc-LLVY-AMC as the substrate. The AMC fluorescence was monitored by a plate reader with excitation and emission filters of 360±40 nm and 460±30 nm, respectively.

  • Coomassie-stained native-PAGE analysis of ab218004 (5 μg).

  • Coomassie-stained SDS-PAGE analysis of ab218004 (5 μg).

References

ab218004 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218004.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up