Native Cow 20S Immunoproteasome protein (ab218003)

Overview

  • Product name

    Native Cow 20S Immunoproteasome protein
  • Protein length

    Full length protein

Description

  • Nature

    Native
  • Source

    Native
  • Amino Acid Sequence
    • Accession
    • Species

      Cow
    • Sequence

      MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSV AKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVED PVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPS GTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQ SGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS
    • Molecular weight

      700 kDa
    • Amino acids

      1 to 248
    • Additional sequence information

      Purified from bovine red blood cells.

Specifications

Our Abpromise guarantee covers the use of ab218003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    > 95 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 0.12% Sodium chloride, 0.03% EDTA, 0.04% Beta mercaptoethanol, 10% Glycerol

General Info

  • Alternative names

    • Proteasome subunit alpha type-7
    • Proteasome subunit RC6-1
    • Proteasome subunit XAPC7
    • PSA7_HUMAN
    • PSMA7
    see all
  • Relevance

    Function: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Plays an important role in the regulation of cell proliferation or cell cycle control, transcriptional regulation, immune and stress response, cell differentiation, and apoptosis. Interacts with some important proteins involved in transcription factor regulation, cell cycle transition, viral replication and even tumor initiation and progression. Inhibits the transactivation function of HIF-1A under both normoxic and hypoxia-mimicking conditions. The interaction with EMAP2 increases the proteasome-mediated HIF-1A degradation under the hypoxic conditions. Plays a role in hepatitis C virus internal ribosome entry site-mediated translation. Mediates nuclear translocation of the androgen receptor (AR) and thereby enhances androgen-mediated transactivation. Promotes MAVS degradation and thereby negatively regulates MAVS-mediated innate immune response. Similarity: Belongs to the peptidase T1A family. PTM: Phosphorylation by ABL1 or ABL2 leads to an inhibition of proteasomal activity and cell cycle transition blocks.

Images

  • Coomassie-stained SDS-PAGE analysis of ab218003 (5 μg).

  • Coomassie-stained native-PAGE analysis of ab218003 (5 μg).

  • Activation of 5 nM ab218003 by 25 nM PA28γ, the proteasome activity was assayed by using 50 µM Suc-LLVY-AMC as the substrate. The AMC fluorescence was monitored by a plate reader with excitation and emission filters of 360±40 nm and 460±30 nm, respectively.

  • Activation of 5 nM ab218003 by 25 nM PA28β, the proteasome activity was assayed by using 50 µM Suc-LLVY-AMC as the substrate. The AMC fluorescence was monitored by a plate reader with excitation and emission filters of 360±40 nm and 460±30 nm, respectively.

  • Activation of 5 nM ab218003 by 25 nM PA28α, the proteasome activity was assayed by using 50 µM Suc-LLVY-AMC as the substrate. The AMC fluorescence was monitored by a plate reader with excitation and emission filters of 360±40 nm and 460±30 nm, respectively.

References

ab218003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up