Native Cow S100 beta protein (ab198633)
Key features and details
- Expression system: Native
- Purity: > 95% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Native Cow S100 beta protein
See all S100 beta proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Expression system
Native -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Native -
-
Species
Cow -
Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE QEVVDKVMETL DSDGDGECDFQEFMAFVAMITTACHEFFEHE -
Predicted molecular weight
6 kDa -
Amino acids
1 to 92 -
Additional sequence information
Prepared from bovine brain tissue from animals under 30 months of age at a USDA inspected facility. Animals were inspected ante and post mortem and found free of infectious diseases.
-
Specifications
Our Abpromise guarantee covers the use of ab198633 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.50
Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.001% DTT -
ReconstitutionWe suggest the addition of de-ionized H2O to the original volume, followed by gentle swirling and/or vortexing to ensure adequate homogenization. If further dilution is required, we suggest using the lyophilization buffer
General Info
-
Alternative names
- NEF
- Protein S100 B
- Protein S100-B
see all -
Function
Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. -
Tissue specificity
Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues. -
Sequence similarities
Belongs to the S-101 family.
Contains 2 EF-hand domains. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
Images
-
SDS-PAGE - Native Cow S100 beta protein (ab198633)
SDS PAGE analysis of ab198633 under reduced and heated conditions:
Lane 1: 5 μg
Lane 2: 10 μg
Lane 3: 20 μg
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab198633 has not yet been referenced specifically in any publications.
