Description

  • Product name

    Native Cow S100 beta protein
    See all S100 beta proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Native
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Species

      Cow
    • Sequence

      MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE QEVVDKVMETL DSDGDGECDFQEFMAFVAMITTACHEFFEHE
    • Predicted molecular weight

      6 kDa
    • Amino acids

      1 to 92
    • Additional sequence information

      Prepared from bovine brain tissue from animals under 30 months of age at a USDA inspected facility. Animals were inspected ante and post mortem and found free of infectious diseases.

Specifications

Our Abpromise guarantee covers the use of ab198633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.001% DTT

  • Reconstitution
    We suggest the addition of de-ionized H2O to the original volume, followed by gentle swirling and/or vortexing to ensure adequate homogenization. If further dilution is required, we suggest using the lyophilization buffer

General Info

  • Alternative names

    • NEF
    • Protein S100 B
    • Protein S100-B
    • S 100 calcium binding protein beta chain
    • S 100 protein beta chain
    • S-100 protein beta chain
    • S-100 protein subunit beta
    • S100
    • S100 calcium binding protein beta (neural)
    • S100 calcium-binding protein B
    • S100 protein beta chain
    • S100B
    • S100B_HUMAN
    • S100beta
    see all
  • Function

    Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling.
  • Tissue specificity

    Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab198633 under reduced and heated conditions:

    Lane 1: 5 μg

    Lane 2: 10 μg

    Lane 3: 20 μg

References

ab198633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up