Description

  • Product name

    Native Human Fibronectin protein
    See all Fibronectin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purified from human plasma
  • Expression system

    Native
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Species

      Human
    • Sequence

      QAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYLGNALVCTCYGG SRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRG RISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKP IAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRC NDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSS GSGPFTDVRAAVYQPQPHPQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQM LCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQD GHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNY TDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIG DQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTF HKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVH GVRYQCYCYGRGIGEWHCQPLQTYPSSSGPVEVFITETPSQPNSHPIQWN APQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQL ISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSPLVATSESVTEI TASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLL PGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRW SRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIY AVEENQESTPVVIQQETTGTPRSDTVPSPRDLQFVEVTDVKVTIMWTPPE SAVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGLSPGVTYYFKVFAVS HGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPPRAQITGYRLTV GLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATGV FTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREV TSDSGSIVVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLH LEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSS CTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPAVPPPTDLRFTNIGPD TMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPG TEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAP RATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVAL NGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRIT YGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASS KPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNG PGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTN IDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPD GEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFT QVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSG LMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTIT ISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKI YLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARIT GYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQK SEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTHPGYDTG NGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVG EEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDTSE YIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNVIVEALKDQQRH KVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKL LCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGN GKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCD NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR EDSRE
    • Amino acids

      32 to 2386
    • Additional sequence information

      Molecular weight: the MW of the hetrodimer is 550 kDa

Specifications

Our Abpromise guarantee covers the use of ab80021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.40
    Constituents: 0.476% HEPES, 0.87% Sodium chloride

  • Reconstitution
    Reconstitute with 1.0 milliliters of water to achieve 2.0 mg/mL. Human Fibronectin is known for its solubility issues. The best way to get this material into solution, after reconstitution, is to incubate in a 37ºC water bath for at least 30 minutes. Typically this is sufficient, however a small amount of un-dissolved material may remain. If this is the case, a few gentle aspirations with a pipette is recommended.

General Info

  • Alternative names

    • CIG
    • Cold insoluble globulin
    • Cold-insoluble globulin
    • DKFZp686F10164
    • DKFZp686H0342
    • DKFZp686I1370
    • DKFZp686O13149
    • ED B
    • Fibronectin 1
    • FINC
    • FINC_HUMAN
    • FN
    • FN1
    • FNZ
    • GFND
    • GFND2
    • LETS
    • Migration stimulating factor
    • MSF
    • Ugl-Y3
    see all
  • Function

    Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts.
    Anastellin binds fibronectin and induces fibril formation. This fibronectin polymer, named superfibronectin, exhibits enhanced adhesive properties. Both anastellin and superfibronectin inhibit tumor growth, angiogenesis and metastasis. Anastellin activates p38 MAPK and inhibits lysophospholipid signaling.
  • Tissue specificity

    Plasma FN (soluble dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. Ugl-Y1, Ugl-Y2 and Ugl-Y3 are found in urine.
  • Involvement in disease

    Glomerulopathy with fibronectin deposits 2
  • Sequence similarities

    Contains 12 fibronectin type-I domains.
    Contains 2 fibronectin type-II domains.
    Contains 16 fibronectin type-III domains.
  • Developmental stage

    Ugl-Y1, Ugl-Y2 and Ugl-Y3 are present in the urine from 0 to 17 years of age.
  • Post-translational
    modifications

    Sulfated.
    It is not known whether both or only one of Thr-2064 and Thr-2065 are/is glycosylated.
    Forms covalent cross-links mediated by a transglutaminase, such as F13A or TGM2, between a glutamine and the epsilon-amino group of a lysine residue, forming homopolymers and heteropolymers (e.g. fibrinogen-fibronectin, collagen-fibronectin heteropolymers).
    Phosphorylated by FAM20C in the extracellular medium.
    Proteolytic processing produces the C-terminal NC1 peptide, anastellin.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix.
  • Information by UniProt

Images

  • Gel: Novex 4-12% Bis-Tris
    Load Load: Human Fibronectin, 1 µg per lane in Non-reducing (NR) and reducing (R) conditions. 
    Buffer: MOPS
    MW Ladder: Myosin (191 kDa), Phosphorylase B (97 kDa), BSA (64 kDa), Glutamic Dehydrogenase (51 kDa), Alcohol Dehydrogenase (39 kDa), Carbonic Anhydrase (28 kDa), Myoglobin Red (19 kDa), Lysozyme (14 kDa)

References

ab80021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for your enquiry. I can confirm that ab80021 Fibronectin protein (Human) is purified from human plasma. This material is native protein. I hope this will be helpful to you. Should you have any further questions, please do not hesitate to contact us.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up