Description

  • Product name

    Native Human IgG3 protein
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Native
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Sequence

      ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEL KTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSC DTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQG NIFSCSVMHEALHNRFTQKSLSLSPGK
    • Predicted molecular weight

      170 kDa
    • Amino acids

      1 to 377
    • Additional sequence information

      Prepared from Human plasma

Specifications

Our Abpromise guarantee covers the use of ab184884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Like IgG1, IgG3 activates complement and has an affinity for fc receptors; thus IgG1 and IgG3 are the more effective of the IgG subclasses. An IgG3 deficiency is associated with Wiscott-Aldrich disease, systemic lupus erythematosus, juvenile diabetes mellitus, and peridontal infections. IgG anti-viral antibodies are restricted to IgG subclasses 1 and 3, with IgG3 antibodies being the first to appear in response to infection.

    ab184884 is non reactive for HbsAG, anti-HCV, anti-HBc, and negative for anti-HIV 1 & 2 by FDA approved tests.

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C. Do Not Freeze.

    pH: 7.4
    Preservative: 0.05% Sodium azide
    Constituents: 0.28% Sodium phosphate, 0.88% Sodium chloride

General Info

  • Alternative names

    • DKFZp686H11213
    • FLJ39988
    • FLJ40036
    • FLJ40253
    • FLJ40587
    • FLJ40789
    • FLJ40834
    • G3m marker
    • HDC
    • Heavy chain disease protein
    • Ig gamma 3 chain C region
    • IgG3
    • IGHG 3
    • IGHG3
    • IGHG3 protein
    • Immunoglobulin gamma 3
    • Immunoglobulin gamma 3 (Gm marker)
    • Immunoglobulin heavy constant gamma 3
    • Immunoglobulin heavy constant gamma 3 (G3m marker)
    • MGC45809
    see all
  • Relevance

    IgG is a monomeric immunoglobulin, built of two heavy chains gamma and two light chains. Each molecule has two antigen binding sites. This is the most abundant immunoglobulin and is approximately equally distributed in blood and in tissue liquids, constituting 75% of serum immunoglobulins in humans. There are 4 subclasses: IgG1 (66%), IgG2 (23%), IgG3 (7%) and IgG4 (4%).
  • Cellular localization

    Secreted

Images

  • Lane 1: Human IgG3 (20µl) Non reducing

    Lane 2: Human IgG3 (10µl) Non reducing

    Lane 3: Human IgG3 (5µl) Non reducing

    Lane 4: Human IgG3 (20µl) Reducing

    Lane 5: Human IgG3 (10µl) Reducing

    Lane 6: Human IgG3 (5µl) Reducing

    Lane 7: Molecular weigth marker

References

ab184884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up