Description

  • Product name

    Native Human IgG4 protein
    See all IgG4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Native
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Species

      Human
    • Sequence

      ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES KYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG NVFSCSVMHEALHNHYTQKSLSLSLGK
    • Predicted molecular weight

      36 kDa
    • Amino acids

      1 to 327
    • Additional sequence information

      Sourced from human normal plasma.

Specifications

Our Abpromise guarantee covers the use of ab183266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab183266 was prepared from normal plasma, shown to be non reactive for HbsAG, anti-HCV, anti-HBc, and negative for anti-HIV 1 & 2 by FDA approved tests.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    pH: 7.40
    Preservative: 0.05% Sodium azide
    Constituents: 0.33% Sodium phosphate, 0.87% Sodium chloride

General Info

  • Alternative names

    • Ig gamma 4 chain C region
    • IGHG4
    • immunoglobulin heavy chain constant region gamma 4
    • Immunoglobulin heavy constant gamma 4 (G4m marker)
    • MGC117419
    see all
  • Relevance

    IgG4 antibodies will dominate the IgG response in schistosomiasis, lymphatic filariasis, and in patients after allergen immunotherapy. Unlike the other IgG subclasses, IgG4 does not activate complement. A combined IgA-IgG4 deficiency has been associated with recurrent pyogenic infections.
  • Cellular localization

    Secreted

References

ab183266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up