Description

  • Product name

    Native Human IgM protein
  • Purity

    > 95 % SDS-PAGE.
    Purified using a proprietary 2-step fractionation procedure. Purified from normal Human Serum/Plasma obtained from healthy donors of US origin.
  • Expression system

    Native
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Sequence

      GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITLSWKYKNNSDI SSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKN VPLPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVSWLR EGKQVGSGVTTDQVQAEAKESGPTTYKVTSTLTIKESDWLGQSMFTCRVD HRGLTFQQNASSMCVPDQDTAIRVFAIPPSFASIFLTKSTKLTCLVTDLT TYDSVTISWTRQNGEAVKTHTNISESHPNATFSAVGEASICEDDWNSGER FTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRESATIT CLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTV SEEEWNTGETYTCVAHEALPNRVTERTVDKSTGKPTLYNVSLVMSDTAGT CY
    • Predicted molecular weight

      49 kDa
    • Amino acids

      1 to 452

Specifications

Our Abpromise guarantee covers the use of ab205807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    pH: 7.2
    Preservative: 0.05% Sodium azide
    Constituents: 0.16% Sodium phosphate, 0.87% Sodium chloride

General Info

  • Alternative names

    • Immunoglobin heavy chain constant region mu
    • AGM1
    • Constant region of heavy chain of IgM
    • DKFZp686I15196
    • DKFZp686I15212
    • FLJ00385
    • Ig mu chain C region
    • IGHM
    • IgM heavy chain constant region
    • Immunoglobin heavy constant mu
    • Immunoglobulin mu
    • MGC104996
    • MGC52291
    • MU
    • VH
    see all
  • Relevance

    IgM normally constitutes about 10% of serum immunoglobulins. IgM antibody is prominent in early immune responses to most antigens and is largely confined to plasma due to it's large size. Monomeric IgM is expressed as a membrane bound antibody on the surface of B cells and as a pentamer when secreted by plasma cells. Due to it's high valency IgM is more efficient than other isotypes is binding antigens with repeating epitopes (virus particles and red blood cells) and is more efficient than IgG in activiating the complement pathway. The gene for the mu constant region contains four domains separated by short intervening sequences. IgM measurement yields information about the body's immediate resistance and response to infection as well as information related to specific diseases. Decreased levels are associated with immune deficiency states, hereditary deficiencies, and myeloma. Increased levels can be associated with Waldenstrom's macroglobulinemia, chronic infection and hepatocellular disease.
  • Cellular localization

    Cell Membrane and Secreted

References

ab205807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up