Description

  • Product name

    Native human MMP9 protein (Proenzyme, monomer)
    See all MMP9 proteins and peptides
  • Biological activity

    ≥1’400mU/mg protein.

    One unit is defined as the amount of enzyme that hydrolyzes 1µmol 2,4-dinitrophenyl-Pro-Gln-Gly-Ile-Ala-Gly-Gln-D-Arg-OH per min. at 37°C, pH 7.0.

  • Purity

    > 95 % SDS-PAGE.
    No other MMP contaminants are detectable.
  • Expression system

    Native
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Species

      Human
    • Sequence

      APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGP ALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHH NITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQ FGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVP TRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFG FCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTAN YDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDG RLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALM YPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCP TGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVN IFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDS VFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRS GRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYRE KAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
    • Predicted molecular weight

      92 kDa
    • Amino acids

      20 to 707
    • Additional sequence information

      Isolated from stimulated human neutrophil granulocytes (buffy coat). Requires activation. Mature protein without signal peptide.
  • Description

    Native human MMP9 protein (Proenzyme)

Specifications

Our Abpromise guarantee covers the use of ab157344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Precursor enzyme needs activation using 2 mM APMA (aminophenylmercuric acetate) for 60-120 min. or 100 µg/ml TPCK-trypsin for 30 min. at 37°C.

    If required trypsin can be inhibited by incubation with 1µl of 1 mg/ml aprotinin solution for 10 min. at 25°C.

    If working with MMP9/TIMP-1 complexes, it is recommended to use stromelysin-1 (MMP3) for activation.

    Incubation at 37°C for 2 hours at 40:1 (MMP9:stromelysin-1) will remove only the propeptide to give the active form of the enzyme.

    The active enzyme is inhibited by TIMP1 (tissue inhibitor of matrix metalloproteinase-1) and by chelators of divalent cations like EDTA or o-phenantroline.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Preservative: 0.05% Sodium azide
    Constituents: 0.05% Brij, 0.06% Calcium chloride, 0.00001% Zinc chloride, 0.79% Tris HCl, 1.16% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 82 kDa matrix metalloproteinase-9
    • 92 kDa gelatinase
    • 92 kDa type IV collagenase
    • CLG 4B
    • CLG4B
    • Collagenase Type 4 beta
    • Collagenase type IV 92 KD
    • EC 3.4.24.35
    • Gelatinase 92 KD
    • Gelatinase B
    • Gelatinase beta
    • GelatinaseB
    • GELB
    • Macrophage gelatinase
    • MANDP2
    • Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
    • Matrix Metalloproteinase 9
    • MMP 9
    • MMP-9
    • MMP9
    • MMP9_HUMAN
    • Type V collagenase
    see all
  • Function

    May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-
    -Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
  • Tissue specificity

    Produced by normal alveolar macrophages and granulocytes.
  • Involvement in disease

    Intervertebral disc disease
    Metaphyseal anadysplasia 2
  • Sequence similarities

    Belongs to the peptidase M10A family.
    Contains 3 fibronectin type-II domains.
    Contains 4 hemopexin repeats.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    Processing of the precursor yields different active forms of 64, 67 and 82 kDa. Sequentially processing by MMP3 yields the 82 kDa matrix metalloproteinase-9.
    N- and O-glycosylated.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix.
  • Information by UniProt

Images

  • All lanes : Anti-MMP9 antibody [EP1254] (ab76003) at 5 µg/ml

    Lane 1 : Native human MMP9 protein (dimer) (ab168863)
    Lane 2 : Native human MMP9 protein (Proenzyme, monomer) (ab157344)
    Lane 3 : Recombinant Mouse MMP9 protein (ab39309)

    Lysates/proteins at 0.1 µg per lane.

    Secondary
    All lanes : Infrared labelled goat anti-rabbit (green) antibody at 1/20000 dilution

    Performed under reducing conditions.


    This blot was produced using a 4-12% Bis-Tris gel under the MOPS buffer system. The gel was run at 200V for 60 minutes before being transferred onto a nitrocellulose membrane at 30V for 70 minutes. The membrane was blocked for an hour before being incubated with anti-MMP9 antibody [EP1254] (ab76003; 5 microgram per mL) at 4°C overnight. Antibody binding was detected using infrared labelled goat anti-rabbit (green) antibody (diluted 1:20000) for 1 hour at room temperature before imaging.

References

This product has been referenced in:

  • Annaházi A  et al. A pilot study on faecal MMP-9: a new noninvasive diagnostic marker of colorectal cancer. Br J Cancer 114:787-92 (2016). Read more (PubMed: 26908323) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157344.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up