Description

  • Product name

  • Purity

    > 95 % SDS-PAGE.
    ab184880 was isolated by a combination of conventional methods and immunoaffinity chromatography.
  • Expression system

    Native
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Species

      Human
    • Sequence

      ANSLLEETKQGNLERECIEELCNKEEAREVFENDPETDYFYPKYLVCLRS FQTGLFTAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKASF TCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFV MLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSC EDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPL NLDTKYELLYLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYA ESIDHSAWLLIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEEL EHSISIKIAKEAVMDINKPGPLFKPENGLLETKVYFAGFPRKVESELIKP INPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIA QFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVD STSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLK IETISHEDLQRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCME VNINGVQLDLDEAISKHNDIRAHSCPSVWKKTKNS
    • Predicted molecular weight

      69 kDa
    • Amino acids

      42 to 676
    • Additional sequence information

      Free protein form isolated from fresh frozen plasma.

Specifications

Our Abpromise guarantee covers the use of ab184880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein S exists in two forms in Human plasma, as the free protein and in complex with C4b-binding protein. ab184880 is the free protein from plasma which serves as a cofactor for the anticoagulant activity of activated protein C.

    Extinction Coefficient: 0.95

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    pH: 7.4
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 0.012% Benzamidine

General Info

  • Alternative names

    • Preproprotein S
    • Propiece of latent protein S
    • PROS
    • PROS 1
    • PROS_HUMAN
    • proS1
    • Protein S alpha
    • Protein Sa
    • PS 21
    • PS 22
    • PS 23
    • PS 24
    • PS 25
    • PS 26
    • PS21
    • PS22
    • PS23
    • PS24
    • PS25
    • PS26
    • PSA
    • THPH5
    • THPH6
    • Vitamin K dependent protein S
    • Vitamin K-dependent plasma protein S
    • Vitamin K-dependent protein S
    see all
  • Function

    Anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.
  • Tissue specificity

    Plasma.
  • Involvement in disease

    Defects in PROS1 are the cause of protein S deficiency (PROS1D) [MIM:612336]; also known as thrombophilia due to protein S deficiency. PROS1D is a cause of hereditary thrombophilia, a hemostatic disorder characterized by impaired regulation of blood coagulation and a tendency to recurrent venous thrombosis. However, many adults with heterozygous disease may be asymptomatic. Based on the plasma levels of total and free PROS1 antigen as well as the serine protease-activated protein C cofactor activity, three types of PROS1D have been described: type I, characterized by reduced total and free PROS1 antigen levels together with reduced anticoagulant activity; type III, in which only free PROS1 antigen and PROS1 activity levels are reduced; and the rare type II which is characterized by normal concentrations of both total and free PROS1 antigen, but low cofactor activity.
  • Sequence similarities

    Contains 4 EGF-like domains.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
    Contains 2 laminin G-like domains.
  • Post-translational
    modifications

    The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab184880 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up