For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    native-human-timp1-protein-ab157282.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Adhesion / ECM Matrix Metalloproteinases TIMP
Share by email

Native Human TIMP1 protein (ab157282)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: Native
  • Purity: > 90% SDS-PAGE
  • Suitable for: WB, SDS-PAGE

You may also be interested in

ELISA
Product image
Human TIMP1 ELISA Kit (ab187394)
Pair
Product image
Human TIMP1 Antibody Pair - BSA and Azide free (ab243977)

View more associated products

Description

  • Product name

    Native Human TIMP1 protein
    See all TIMP1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purity: 92% (SDS-PAGE, Western blot).
  • Expression system

    Native
  • Accession

    P01033
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Species

      Human
    • Sequence

      CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQ ALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCS FVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQ LLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
    • Predicted molecular weight

      28 kDa
    • Amino acids

      24 to 207

Associated products

  • Related Products

    • Anti-TIMP1 antibody [2A5] (ab2464)
    • Anti-TIMP1 antibody - Carboxyterminal end (ab38978)
    • Anti-TIMP1 antibody (ab61224)

Specifications

Our Abpromise guarantee covers the use of ab157282 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Note: It is recommended to perform a preincubation of ~20 min. at 37°C to allow formation of the enzyme-inhibitor complex.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 0.05% Sodium azide
    Constituents: 0.05% Brij, 0.05% Calcium chloride, 0.00001% Zinc chloride, 0.79% Tris HCl, 1.17% Sodium chloride

General Info

  • Alternative names

    • Clgi
    • Collagenase inhibitor
    • Collagenase inhibitor, Human
    • EPA
    • EPO
    • Erythroid Potentiating Activity
    • Erythroid-potentiating activity
    • Fibroblast collagenase inhibitor
    • FLJ90373
    • HCI
    • Human Collagenase Inhibitor
    • Metalloproteinase inhibitor 1
    • Metalloproteinase inhibitor 1 precursor
    • OTTHUMP00000023214
    • TIMP
    • TIMP 1
    • TIMP metallopeptidase inhibitor 1
    • TIMP-1
    • Timp1
    • TIMP1 protein
    • TIMP1_HUMAN
    • Tissue Inhibitor of Metalloproteinase 1
    • Tissue inhibitor of metalloproteinases
    • Tissue inhibitor of metalloproteinases 1
    • Ttissue inhibitor of metalloproteinase 1 erythroid potentiating activity collagenase inhibitor
    see all
  • Function

    Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13 and MMP-16. Does not act on MMP-14.
  • Sequence similarities

    Belongs to the protease inhibitor I35 (TIMP) family.
    Contains 1 NTR domain.
  • Post-translational
    modifications

    The activity of TIMP1 is dependent on the presence of disulfide bonds.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P01033 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (1)

Publishing research using ab157282? Please let us know so that we can cite the reference in this datasheet.

ab157282 has been referenced in 1 publication.

  • Lachowski D  et al. Matrix stiffness modulates the activity of MMP-9 and TIMP-1 in hepatic stellate cells to perpetuate fibrosis. Sci Rep 9:7299 (2019). PubMed: 31086224

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab157282.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.