Native Human TIMP1 protein (ab157282)
Key features and details
- Expression system: Native
- Purity: > 90% SDS-PAGE
- Suitable for: WB, SDS-PAGE
Description
-
Product name
Native Human TIMP1 protein
See all TIMP1 proteins and peptides -
Purity
> 90 % SDS-PAGE.
Purity: 92% (SDS-PAGE, Western blot). -
Expression system
Native -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Native -
-
Species
Human -
Sequence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQ ALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCS FVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQ LLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA -
Predicted molecular weight
28 kDa -
Amino acids
24 to 207
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab157282 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
SDS-PAGE
-
Form
Liquid -
Additional notes
Note: It is recommended to perform a preincubation of ~20 min. at 37°C to allow formation of the enzyme-inhibitor complex. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 7.00
Preservative: 0.05% Sodium azide
Constituents: 0.05% Brij, 0.05% Calcium chloride, 0.00001% Zinc chloride, 0.79% Tris HCl, 1.17% Sodium chloride
General Info
-
Alternative names
- Clgi
- Collagenase inhibitor
- Collagenase inhibitor, Human
see all -
Function
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13 and MMP-16. Does not act on MMP-14. -
Sequence similarities
Belongs to the protease inhibitor I35 (TIMP) family.
Contains 1 NTR domain. -
Post-translational
modificationsThe activity of TIMP1 is dependent on the presence of disulfide bonds. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab157282 has been referenced in 1 publication.
- Lachowski D et al. Matrix stiffness modulates the activity of MMP-9 and TIMP-1 in hepatic stellate cells to perpetuate fibrosis. Sci Rep 9:7299 (2019). PubMed: 31086224