Description

  • Product name

    Native Human Transferrin protein
    See all Transferrin proteins and peptides
  • Biological activity

    Iron Content: >= 1100 ug per gram.
  • Purity

    > 95 % SDS-PAGE.
    Sterile filtered using 0.2 micron filter. Endotoxin Level: <=0.1EU/mg by LAL testing.
  • Expression system

    Native
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Species

      Human
    • Sequence

      PDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRA IAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVV KKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVA NFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGD VAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTV VARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHG FLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKPVKWCALSHHE RLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGK CGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKKSASDLTWDNLKGKKSCH TAVGRTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGS GLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKNPDPWA KNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKIL RQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYL GEEYVKAVGNLRKCSTSSLLEACTFRRP
    • Amino acids

      20 to 698

Specifications

Our Abpromise guarantee covers the use of ab91435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Prepared from plasma shown to be non reactive for HBsAg, anti-HCV, anti-HBc, and negative for anti-HIV 1 & 2 by FDA approved tests.

    Iron Content: >= 1100 ug per gram.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    pH: 7.40
    Constituents: 0.328% Sodium phosphate, 0.87% Sodium chloride

General Info

  • Alternative names

    • Apotransferrin
    • Beta 1 metal binding globulin
    • Beta-1 metal-binding globulin
    • DKFZp781D0156
    • PRO1400
    • PRO1557
    • PRO2086
    • Serotransferrin
    • Serotransferrin precursor
    • Siderophilin
    • TF
    • TFQTL1
    • Transferin
    • Transferrin
    • TRFE_HUMAN
    see all
  • Function

    Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Involvement in disease

    Defects in TF are the cause of atransferrinemia (ATRAF) [MIM:209300]. Atransferrinemia is rare autosomal recessive disorder characterized by iron overload and hypochromic anemia.
  • Sequence similarities

    Belongs to the transferrin family.
    Contains 2 transferrin-like domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE: 4-12% Bis-Tris gel
    Lane 1. 5 μg Transferrin (non-reduced/ no heat)
    Lane 2. 10 μg Transferrin (non-reduced/ no heat)
    Lane 3. 20 μg Transferrin (non-reduced/ no heat)

References

ab91435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab91435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up