Description

  • Product name

    Native Rat Thrombin protein
    See all Thrombin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Native
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Native
    • Species

      Rat
    • Sequence

      TFGLGEADCGLRPLFEKKSLTDKTEKELLDSYIDGRIVEGWDAEKGIAPW QVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLLVRIG KHSRTRYERNVEKISMLEKIYIHPRYNWRENLDRDIALLKLKKPVPFSDY IHPVCLPDKQTVTSLLQAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVN LPIVERPVCKASTRIRITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSP YNHRWYQMGIVSWGEGCDRNGKYGFYTHVFRLKRWMQKVIDQHR
    • Predicted molecular weight

      37 kDa
    • Amino acids

      324 to 617
    • Additional sequence information

      Prepared from purified rat prothrombin by activation with Russells Viper Venom. This venom is removed after activation.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab185262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 6.5
    Constituents: 0.0132% Sodium citrate, 1.17% Sodium chloride, 0.1% Polyethylene glycol

General Info

  • Alternative names

    • Coagulation factor II
    • Coagulation factor II thrombin
    • EC 3.4.21.5
    • F2
    • Factor II
    • Prepro coagulation factor II
    • Prothrombin
    • Prothrombin B chain
    • PT
    • RPRGL2
    • Serine protease
    • THPH1
    • THRB_HUMAN
    • Thrombin heavy chain
    see all
  • Function

    Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostasis, inflammation and wound healing.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Involvement in disease

    Factor II deficiency
    Ischemic stroke
    Thrombophilia due to thrombin defect
    Pregnancy loss, recurrent, 2
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
    Contains 2 kringle domains.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    The gamma-carboxyglutamyl residues, which bind calcium ions, result from the carboxylation of glutamyl residues by a microsomal enzyme, the vitamin K-dependent carboxylase. The modified residues are necessary for the calcium-dependent interaction with a negatively charged phospholipid surface, which is essential for the conversion of prothrombin to thrombin.
    N-glycosylated. N-glycan heterogeneity at Asn-121: Hex3HexNAc3 (minor), Hex4HexNAc3 (minor) and Hex5HexNAc4 (major). At Asn-143: Hex4HexNAc3 (minor) and Hex5HexNAc4 (major).
  • Cellular localization

    Secreted, extracellular space.
  • Information by UniProt

References

ab185262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up