Anti-Natriuretic peptides A antibody (ab180649)
Key features and details
- Rabbit polyclonal to Natriuretic peptides A
- Suitable for: WB
- Reacts with: Mouse
- Isotype: IgG
Overview
-
Product name
Anti-Natriuretic peptides A antibody
See all Natriuretic peptides A primary antibodies -
Description
Rabbit polyclonal to Natriuretic peptides A -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse -
Immunogen
Recombinant fragment corresponding to Human Natriuretic peptides A aa 26-151.
Sequence:NPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALS PLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSL RRSSCFGGRMDRIGAQSGLGCNSFRY
Database link: P01160 -
Positive control
- WB: Mouse brain, heart and lung tissue lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180649 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 16 kDa.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 16 kDa. |
Target
-
Function
Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. -
Involvement in disease
Atrial standstill 2
Atrial fibrillation, familial, 6 -
Sequence similarities
Belongs to the natriuretic peptide family. -
Post-translational
modificationsCleaved by CORIN upon secretion to produce the functional hormone.
Atrial natriuretic factor: Cleaved by MME. The cleavage initiates degradation of the factor and thereby regulate its activity. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 230899 Mouse
- SwissProt: P05125 Mouse
-
Alternative names
- ANF antibody
- ANF_HUMAN antibody
- ANP antibody
see all
Images
-
All lanes : Anti-Natriuretic peptides A antibody (ab180649) at 1/1000 dilution
Lane 1 : Mouse brain tissue lysate
Lane 2 : Mouse heart tissue lysate
Lane 3 : Mouse lung tissue lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L)
Developed using the ECL technique.
Predicted band size: 16 kDa
Exposure time: 60 secondsBlocking buffer: 3% nonfat dry milk in TBST.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (15)
ab180649 has been referenced in 15 publications.
- Li RJ et al. Rhein ameliorates transverse aortic constriction-induced cardiac hypertrophy via regulating STAT3 and p38 MAPK signaling pathways. Front Pharmacol 13:940574 (2022). PubMed: 36091816
- Xu JJ et al. Loganin Inhibits Angiotensin II-Induced Cardiac Hypertrophy Through the JAK2/STAT3 and NF-?B Signaling Pathways. Front Pharmacol 12:678886 (2021). PubMed: 34194329
- Wu QR et al. High glucose induces Drp1-mediated mitochondrial fission via the Orai1 calcium channel to participate in diabetic cardiomyocyte hypertrophy. Cell Death Dis 12:216 (2021). PubMed: 33637715
- Zheng H et al. circSnx12 Is Involved in Ferroptosis During Heart Failure by Targeting miR-224-5p. Front Cardiovasc Med 8:656093 (2021). PubMed: 33969020
- Xu Y et al. MBNL1 regulates isoproterenol-induced myocardial remodelling in vitro and in vivo. J Cell Mol Med 25:1100-1115 (2021). PubMed: 33295096