Overview

  • Product name
    Anti-Natriuretic peptides A antibody
    See all Natriuretic peptides A primary antibodies
  • Description
    Rabbit polyclonal to Natriuretic peptides A
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Natriuretic peptides A aa 26-151.
    Sequence:

    NPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALS PLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSL RRSSCFGGRMDRIGAQSGLGCNSFRY


    Database link: P01160

  • Positive control
    • WB: PC3 cell line extract, BT-474, HepG2, HL-60, Mouse heart, Mouse liver, Rat liver, Human rectal cancer, rat heart, human stomach, U2OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab180649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 16 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

ICC/IF 1/10 - 1/100.

Target

  • Function
    Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.
  • Involvement in disease
    Atrial standstill 2
    Atrial fibrillation, familial, 6
  • Sequence similarities
    Belongs to the natriuretic peptide family.
  • Post-translational
    modifications
    Cleaved by CORIN upon secretion to produce the functional hormone.
    Atrial natriuretic factor: Cleaved by MME. The cleavage initiates degradation of the factor and thereby regulate its activity.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • ANF antibody
    • ANF_HUMAN antibody
    • ANP antibody
    • ATFB6 antibody
    • Atrial natriuretic factor antibody
    • Atrial natriuretic peptide antibody
    • Atriopeptin antibody
    • Cardiodilatin antibody
    • Cardiodilatin related peptide antibody
    • Cardiodilatin-related peptide antibody
    • Cardionatrin antibody
    • CDD ANF antibody
    • CDD antibody
    • CDD-ANF antibody
    • CDP antibody
    • Natriuretic peptide A antibody
    • Natriuretic peptide precursor A antibody
    • NPPA antibody
    • PND antibody
    • Prepronatriodilatin antibody
    see all

Images

  • All lanes : Anti-Natriuretic peptides A antibody (ab180649) at 1/1000 dilution

    Lane 1 : BT474 with 3% nonfat dry milk in TBST
    Lane 2 : HepG2 with 3% nonfat dry milk in TBST
    Lane 3 : HL60 with 3% nonfat dry milk in TBST
    Lane 4 : Mouse heart with 3% nonfat dry milk in TBST
    Lane 5 : Mouse liver with 3% nonfat dry milk in TBST
    Lane 6 : Rat liver with 3% nonfat dry milk in TBST.

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG at 1/10000 dilution

    Predicted band size: 16 kDa


    Exposure time: 1 second
  • Immunohistochemistry of paraffin-embedded human rectal cancer staining Natriuretic peptides A using ab180649 at dilution of 1:200

  • Immunofluorescence analysis of U2OS cells staining natriuretic peptides A using (ab180649). Blue: DAPI for nuclear staining.

     

  • Anti-Natriuretic peptides A antibody (ab180649) at 1/500 dilution + Mouse heart tissue lysate

    Predicted band size: 16 kDa



    Primary: ab180649, 1/500 dilution, Lane 1: Mouse heart tissue lysate.
  • Immunohistochemistry of paraffin-embedded human stomach staining Natriuretic peptides A using ab180649 at dilution of 1:200

  • Immunohistochemistry of paraffin-embedded rat heart staining Natriuretic peptides A using ab180649 at dilution of 1:200

References

This product has been referenced in:
  • Holloway TM  et al. High intensity interval and endurance training have opposing effects on markers of heart failure and cardiac remodeling in hypertensive rats. PLoS One 10:e0121138 (2015). WB ; Rat . Read more (PubMed: 25803693) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up