Overview

Description

  • Nature
    Native
  • Source
    Native
  • Amino Acid Sequence
    • Accession
    • Species
      Cow
    • Sequence
      STSATDTHHVEMARERSKTVTSFYNQSAIDVAAEKPSVRLTPTMMLYSGR SQDGSHLLKSARYLQQELPVRIAHRIKGFRSLPFIIGCNPTILHVHELYI RAFQKLTDFPPIKDQADEARYCQLVRQLLDDHKDVVTLLAEGLRESRKYI EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKI IEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNA MRATMESHLDTPYNVPDVVITIANNDIDLVIRISDRGGGIAHKDLDRVMD YHFTTAEASTQDPRISPLFGHLDLHSGGQSGPMHGFGFGLPTSRAYAEYL GGSLRLQSLQGIGTDVYLRLRHIDGREESFRI
    • Amino acids
      31 to 412
    • Additional sequence information
      subunit apparent Mr's 52,000 (E2), 46,000 (E1alpha), 35,000 (E1beta). Apparent Mr~ 3,200,000 by sedimentation equilibrium centrifugation. Source = bovine kidney

Specifications

Our Abpromise guarantee covers the use of ab176939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    ~ 8-10 mmol of NADH formed per min per mg of protein with α-ketoisovalerate as substrate.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Additional notes

    Source: bovine kidney

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.30
    Constituents: 0.79% Tris HCl, 0.11% Beta mercaptoethanol, 0.012% Benzamidine, 0.002% PMSF, 0.03% EDTA, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • [3 methyl 2 oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial
    • [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase
    • BCKD kinase
    • BCKD-kinase
    • BCKD_HUMAN
    • BCKDHKIN
    • Bckdk
    • BCKDKD
    • BDK
    • Branched chain alpha keto acid dehydrogenase kinase
    • Branched chain ketoacid dehydrogenase kinase
    • Branched-chain alpha-ketoacid dehydrogenase kinase
    • mitochondrial
    see all
  • Function
    Catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. Key enzyme that regulate the activity state of the BCKD complex.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the PDK/BCKDK protein kinase family.
    Contains 1 histidine kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

References

ab176939 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up