Overview

  • Product name

  • Description

    Rabbit polyclonal to NBAS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NBAS aa 1-70.
    Sequence:

    MAAPESGPALSPGTAEGEEETILYDLLVNTEWPPETEVQPRGNQKHGASF IITKAIRDRLLFLRQYIWYS


    Database link: A2RRP1

  • Positive control

    • IHC-P: Human heart and pancreatic cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Broadly expressed, with highest levels in heart and skeletal muscle, and lowest levels in liver, small intestine and thymus. Up-regulated together with N-myc in some neuroblastoma cell lines.
  • Sequence similarities

    Contains 2 WD repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • NBAS antibody
    • NBAS_HUMAN antibody
    • Neuroblastoma-amplified gene protein antibody
    • Neuroblastoma-amplified sequence antibody

Images

  • Paraffin-embedded human heart tissue stained for NBAS using ab234881 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic cancer tissue stained for NBAS using ab234881 at 1/100 dilution in immunohistochemical analysis.

References

ab234881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up