Overview

  • Product name

    Anti-NBPF10 antibody - C-terminal
  • Description

    Rabbit polyclonal to NBPF10 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human NBPF10 aa 706-754 (C terminal). The exact sequence is proprietary.
    Sequence:

    VLQDSLDRCYSTPSSCLEQPDSCQPYGSSFYALEEKHVGFSLDVGEIEK


    Database link: Q6P3W6-2

  • Positive control

    • HepG2 whole cell lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab178910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 87 kDa.

Target

  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • AB6 antibody
    • AG1 antibody
    • NBPF9 antibody
    • neuroblastoma breakpoint family member 10 antibody
    • RP11-458D21.4 antibody
    see all

Images

  • Anti-NBPF10 antibody - C-terminal (ab178910) at 1 µg/ml + HepG2 whole cell lysate at 10 µg

    Predicted band size: 87 kDa

References

ab178910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up