Overview

  • Product name

  • Description

    Rabbit polyclonal to NBR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NBR1 aa 83-162.
    Sequence:

    HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPA VQSFPLVPCDTDQPQDKPPDWFTSYLETFR


    Database link: Q14596

  • Positive control

    • Human A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab219862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Acts probably as a receptor for selective autophagosomal degradation of ubiquitinated targets.
  • Sequence similarities

    Contains 1 OPR domain.
    Contains 1 UBA domain.
    Contains 1 ZZ-type zinc finger.
  • Domain

    The OPR domain mediates interaction with SQSTM1.
  • Cellular localization

    Cytoplasm. Cytoplasmic vesicle > autophagosome. Lysosome. Cytoplasm > myofibril > sarcomere > M line. In cardiac muscles localizes to the sarcomeric M line (By similarity). Is targeted to lysosomes for degradation.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1A1 3B antibody
    • 1A13B antibody
    • B box protein antibody
    • Cell migration-inducing gene 19 protein antibody
    • KIAA0049 antibody
    • M17S2 antibody
    • Membrane component chromosome 17 surface marker 2 antibody
    • Membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125) antibody
    • MIG 19 antibody
    • MIG19 antibody
    • Migration inducing protein 19 antibody
    • NBR 1 antibody
    • Nbr1 antibody
    • NBR1, autophagy cargo receptor antibody
    • NBR1_HUMAN antibody
    • Neighbor of BRCA1 gene 1 antibody
    • Neighbor of BRCA1 gene 1 protein antibody
    • Next to BRCA1 gene 1 protein antibody
    • Ovarian carcinoma antigen CA125 antibody
    • Protein 1A1-3B antibody
    see all

Images

  • Immunofluorescent analysis of A549 cells (PFA-fixed/Triton X-100 permeabilized) labeling NBR1 with ab219862 at 4 µg/ml (green).

References

ab219862 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up