Overview

  • Product name

  • Description

    Rabbit polyclonal to NCAM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow
  • Immunogen

    Recombinant fragment corresponding to Human NCAM aa 479-563.
    Sequence:

    DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQ FDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK


    Database link: P13591

  • Positive control

    • Human cerebral cortex tissue; U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 94 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling NCAM with ab204446 at 1/50 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling NCAM with ab204446 at 4µg/ml (green).

  • Anti-NCAM antibody (ab204446) + Human cerebral cortex

    Secondary
    NCAM

    Predicted band size: 94 kDa

References

ab204446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up