Overview

  • Product name

    Anti-NCAM1 antibody [1G4]
    See all NCAM1 primary antibodies
  • Description

    Mouse monoclonal [1G4] to NCAM1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Dog, Human, African green monkey
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human NCAM1 aa 20-718. Produced in E. coli.
    Sequence:

    LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRI SVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLM FKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVL SNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQN IVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDS SQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAM ELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHM VVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQ GPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTP SASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVE PYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEG IVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQGEPSAPKLEG QMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHV MLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSG


    Database link: P13591

  • Positive control

    • WB: pCMV6-ENTRY NCAM1-transfected HEK-293 T whole cell lysate; HeLa, SVT2, A549, COS-7, Jurkat, MDCK, PC-12 and MCF7 whole cell lysate. IHC-P: Human cerebellum and cortex tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/4000. Predicted molecular weight: 95 kDa.
IHC-P Use a concentration of 10 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human cerebellum tissue stained for NCAM1 using ab230724 at 10 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human cortex tissue stained for NCAM1 using ab230724 at 10 μg/ml in immunohistochemical analysis.

  • All lanes : Anti-NCAM1 antibody [1G4] (ab230724) at 1/200 dilution

    Lane 1 : pCMV6-ENTRY control-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : pCMV6-ENTRY NCAM1-transfected HEK-293T whole cell lysate

    Lysates/proteins at 5 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 95 kDa

  • All lanes : Anti-NCAM1 antibody [1G4] (ab230724) at 1/200 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : SVT2 whole cell lysate
    Lane 4 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) whole cell lysate
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 7 : MDCK (canine kidney cell line) whole cell lysate
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) whole cell lysate
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Lysates/proteins at 35 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 95 kDa

References

ab230724 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up