Anti-NCAM1 antibody (ab202980)

Submit a review Submit a question
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NCAM antibody (ab202980)

    Key features and details

    • Rabbit Polyclonal to NCAM1
    • Suitable for: IHC-P
    • Reacts with: Rat
    • Isotype: IgG

    Overview

    • Product name

      Anti-NCAM1 antibody
      See all NCAM1 primary antibodies

    • Description

      Rabbit Polyclonal to NCAM1

    • Host species

      Rabbit

    • Tested applications

      Suitable for: IHC-Pmore details

    • Species reactivity

      Reacts with: Rat
      Predicted to work with: Mouse, Chicken, Cow, Human

    • Immunogen

      Synthetic peptide within Human NCAM aa 640-690 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
      Sequence:

      SPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQ Q


      Database link: P13591
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    • Positive control

      • rat brain tissues.

    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    Applications

    Our Abpromise guarantee covers the use of ab202980 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    Target

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NCAM antibody (ab202980)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NCAM antibody (ab202980)

      Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue, labeling NCAM using ab202980 at a 1/200 dilution, followed by conjugation of the secondary antibody and DAB staining.

    References (0)

    Publishing research using ab202980? Please let us know so that we can cite the reference in this datasheet.

    ab202980 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab202980.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com