Anti-NCAM1 antibody (ab202980)
Key features and details
- Rabbit Polyclonal to NCAM1
- Suitable for: IHC-P
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-NCAM1 antibody
See all NCAM1 primary antibodies -
Description
Rabbit Polyclonal to NCAM1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse, Chicken, Cow, Human -
Immunogen
Synthetic peptide within Human NCAM aa 640-690 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:SPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQ Q
Database link: P13591 -
Positive control
- rat brain tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab202980 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. -
Sequence similarities
Contains 2 fibronectin type-III domains.
Contains 5 Ig-like C2-type (immunoglobulin-like) domains. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 428253 Chicken
- Entrez Gene: 281941 Cow
- Entrez Gene: 4684 Human
- Entrez Gene: 17967 Mouse
- Entrez Gene: 24586 Rat
- Omim: 116930 Human
- SwissProt: P13590 Chicken
- SwissProt: P31836 Cow
see all -
Alternative names
- antigen MSK39 identified by monoclonal antibody 5.1H11 antibody
- antigen recognized by monoclonal antibody 5.1H11 antibody
- CD56 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NCAM antibody (ab202980)
Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue, labeling NCAM using ab202980 at a 1/200 dilution, followed by conjugation of the secondary antibody and DAB staining.
Datasheets and documents
References (0)
ab202980 has not yet been referenced specifically in any publications.