Anti-NCAM1 antibody (ab202980)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-NCAM1 antibody
See all NCAM1 primary antibodies -
Description
Rabbit Polyclonal to NCAM1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse, Chicken, Cow, Human
-
Immunogen
Synthetic peptide within Human NCAM aa 640-690 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:SPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQ Q
Database link: P13591 -
Positive control
- rat brain tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab202980 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. -
Sequence similarities
Contains 2 fibronectin type-III domains.
Contains 5 Ig-like C2-type (immunoglobulin-like) domains. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 428253 Chicken
- Entrez Gene: 281941 Cow
- Entrez Gene: 4684 Human
- Entrez Gene: 17967 Mouse
- Entrez Gene: 24586 Rat
- Omim: 116930 Human
- SwissProt: P13590 Chicken
- SwissProt: P31836 Cow
see all -
Alternative names
- antigen MSK39 identified by monoclonal antibody 5.1H11 antibody
- antigen recognized by monoclonal antibody 5.1H11 antibody
- CD56 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NCAM antibody (ab202980)Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue, labeling NCAM using ab202980 at a 1/200 dilution, followed by conjugation of the secondary antibody and DAB staining.
Protocols
Datasheets and documents
References
ab202980 has not yet been referenced specifically in any publications.
