Overview

  • Product name

  • Description

    Rabbit polyclonal to NCAM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Pig
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human NCAM1 aa 340-608. Two N-terminal tags, (Expressed in E.coli).
    Sequence:

    TWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTD AGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVF AYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNC TAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVP ILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAAL NGKGLGEISAASEFKTQPV


    Database link: P13591

  • Positive control

    • IHC-P: Human stomach, glioma and brain tissue. WB: Recombinant human NCAM1 protein; Pig, mouse and rat brain tissue lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab232781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • All lanes : Anti-NCAM1 antibody (ab232781) at 2 µg/ml

    Lane 1 : Pig brain tissue lysate.
    Lane 2 : Mouse brain tissue lysate.
    Lane 3 : Rat brain tissue lysate.
  • Anti-NCAM1 antibody (ab232781) at 2 µg/ml + Recombinant human NCAM1 protein.
  • Formalin-fixed, paraffin-embedded human brain tissue stained for NCAM1 using ab232781 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for NCAM1 using ab232781 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for NCAM1 using ab232781 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab232781 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up