Overview

  • Product name

    Anti-NCAM1 antibody [NCAM1/784] - BSA and Azide free
    See all NCAM1 primary antibodies
  • Description

    Mouse Monoclonal [NCAM1/784] to NCAM1 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human NCAM aa 1-858.
    Sequence:

    MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDK DISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTG EDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTII WKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEIN FKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKD GEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATI HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISS EEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNT IGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFR DGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESL EFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAV GEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAA SEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYR ALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVF RTSAQPTAIPANGSPTSGLSTGAIVGILIVIFVLLLVVVDITCYFLNKCG LFMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPN HDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQ TKENESKA


    Database link: P13591

  • Positive control

    • Human colon tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab216010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Primary incubation for 30 minutes at RT.

Target

  • Function

    This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.
  • Sequence similarities

    Contains 2 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • antigen MSK39 identified by monoclonal antibody 5.1H11 antibody
    • antigen recognized by monoclonal antibody 5.1H11 antibody
    • CD56 antibody
    • cell adhesion molecule, neural, 1 antibody
    • MSK 39 antibody
    • MSK39 antibody
    • N-CAM-1 antibody
    • NCAM 1 antibody
    • NCAM antibody
    • NCAM C antibody
    • NCAM-1 antibody
    • NCAM1 antibody
    • NCAM1_HUMAN antibody
    • NCAMC antibody
    • Neural cell adhesion molecule 1 antibody
    • Neural cell adhesion molecule NCAM antibody
    • OTTHUMP00000235666 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human colon tissue labeling NCAM with ab216010 at 1 μg/ml dilution.

References

ab216010 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216010.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up