Overview

  • Product name

  • Description

    Rabbit polyclonal to NCAM2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human NCAM2 aa 21-297. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    LQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRVVVQ KEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREV VSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTISDNRFAMLANNN LQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAISMPQKSFNA TAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRN IINSDGGPYVCRATNKAGEDEKQAFLQ


    Database link: O15394

  • Positive control

    • IHC-P: Human cerebrum and kidney tissues. WB: Recombinant human NCAM2 protein; Pig and rat brain lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab232923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 93 kDa.

Target

  • Function

    May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.
  • Tissue specificity

    Expressed most strongly in adult and fetal brain.
  • Sequence similarities

    Contains 2 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cell adhesion molecule, neural, 2 antibody
    • MGC51008 antibody
    • N CAM 2 antibody
    • N CAM 21 antibody
    • N CAM2 antibody
    • N CAM21 antibody
    • N-CAM-2 antibody
    • NCAM 2 antibody
    • NCAM 21 antibody
    • NCAM-2 antibody
    • Ncam2 antibody
    • NCAM2_HUMAN antibody
    • NCAM21 antibody
    • Neural cell adhesion molecule 2 antibody
    • OCAM GPI antibody
    • R4B12 antibody
    • RB 8 neural cell adhesion molecule antibody
    • RB8 neural cell adhesion molecule antibody
    • RNCAM antibody
    see all

Images

  • All lanes : Anti-NCAM2 antibody (ab232923) at 1 µg/ml

    Lane 1 : Pig brain lysate
    Lane 2 : Rat brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 93 kDa

  • Anti-NCAM2 antibody (ab232923) at 1 µg/ml + Recombinant human NCAM2 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 93 kDa

  • Paraffin-embedded human kidney tissue stained for NCAM2 using ab232923 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for NCAM2 using ab232923 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab232923 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up