Overview

  • Product name

  • Description

    Rabbit polyclonal to NCAPH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NCAPH2 aa 356-449.
    Sequence:

    AAKLQDFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLR KLQRREVAEQWLRPAEEDHLEDSLEDLGAADDFLEPEEYMEPEG


    Database link: Q6IBW4

  • Positive control

    • WB: Human liver lysate. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 68 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Regulatory subunit of the condensin-2 complex, a complex that seems to provide chromosomes with an additional level of organization and rigidity and in establishing mitotic chromosome architecture. May play a role in lineage-specific role in T-cell development.
  • Sequence similarities

    Belongs to the CND2 H2 (condensin-2 subunit 2) family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Chromosome. Distributed along the arms of chromosomes assembled in vivo and in vitro.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAP H2 antibody
    • CAP H2 subunit of the condensin II complex antibody
    • CAPH2 antibody
    • Chromosome associated protein H2 antibody
    • Chromosome-associated protein H2 antibody
    • CNDH2_HUMAN antibody
    • Condensin-2 complex subunit H2 antibody
    • hCAP H2 antibody
    • hCAP-H2 antibody
    • Kleisin beta antibody
    • Kleisin-beta antibody
    • Ncaph2 antibody
    • Non SMC condensin II complex subunit H2 antibody
    • Non-SMC condensin II complex subunit H2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for NCAPH2 (green) using ab221722 at 4 µg/ml in ICC/IF. 

  • All lanes : Anti-NCAPH2 antibody (ab221722) at 1/500 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate

    Predicted band size: 68 kDa

References

ab221722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HeLa)
Permeabilization
Yes - 0.5% Triton X-100
Specification
HeLa
Fixative
Paraformaldehyde

Dr. Kirk Mcmanus

Verified customer

Submitted Jan 04 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up