Overview

  • Product name

    Anti-NCBP2 antibody - N-terminal
    See all NCBP2 primary antibodies
  • Description

    Rabbit polyclonal to NCBP2 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human NCBP2 aa 1-48 (N terminal).
    Sequence:

    MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLS


    Database link: P52298

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: U-2 OS cells. WB: NCBP2 overexpression HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224569 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 18 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    NCBP2 is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. It has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity.
  • Cellular localization

    Cytoplasmic and Nuclear
  • Database links

  • Alternative names

    • 20 kDa nuclear cap binding protein antibody
    • CBC2 antibody
    • CBP20 antibody
    • Cell proliferation inducing gene 55 protein antibody
    • NCBP 2 antibody
    • NCBP 20 kDa subunit antibody
    • NCBP interacting protein 1 antibody
    • NIP1 antibody
    • Nuclear cap binding protein subunit 2 antibody
    • PIG55 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for NCBP2 (green) using ab224569 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human testis tissue stained for NCBP2 with ab224569 at 1/20 dilution in immunohistochemical analysis.

  • All lanes : Anti-NCBP2 antibody - N-terminal (ab224569) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : NCBP2 overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Developed using the ECL technique.

    Predicted band size: 18 kDa

References

This product has been referenced in:

  • Park R & Miller G Epstein-Barr Virus-Induced Nodules on Viral Replication Compartments Contain RNA Processing Proteins and a Viral Long Noncoding RNA. J Virol 92:N/A (2018). Read more (PubMed: 30068640) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224569.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up