Overview

  • Product name
    Anti-NCF1 / p47-phox antibody
    See all NCF1 / p47-phox primary antibodies
  • Description
    Rabbit polyclonal to NCF1 / p47-phox
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human NCF1/ p47-phox.
    Sequence:

    MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEF HKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCGT LMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTAT DITGPIILQTYRAIANYEKTSGSEMALSTG DVVEVVEKSESGWWFCQM KAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLL EGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGA PPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGS PLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV


    Database link: P14598

  • Positive control
    • Recombinant protein; RAW 264.7 cell lysate.
  • General notes

    Previously labelled as NCF1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab176483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Detects a band of approximately 50 kDa (predicted molecular weight: 45 kDa).

Target

  • Function
    NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production).
  • Involvement in disease
    Defects in NCF1 are the cause of chronic granulomatous disease autosomal recessive cytochrome-b-positive type 1 (CGD1) [MIM:233700]. Chronic granulomatous disease is a genetically heterogeneous disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life-threatening bacterial/fungal infections.
  • Sequence similarities
    Contains 1 PX (phox homology) domain.
    Contains 2 SH3 domains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • 47 kDa autosomal chronic granulomatous disease protein antibody
    • 47 kDa neutrophil oxidase factor antibody
    • NADPH oxidase organizer 2 antibody
    • NCF 47K antibody
    • NCF-1 antibody
    • NCF-47K antibody
    • Ncf1 antibody
    • NCF1_HUMAN antibody
    • Neutrophil cytosol factor 1 antibody
    • Neutrophil cytosolic factor 1 antibody
    • neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1) antibody
    • Neutrophil NADPH oxidase factor 1 antibody
    • Nox organizer 2 antibody
    • Nox organizing protein 2 antibody
    • Nox-organizing protein 2 antibody
    • NOXO2 antibody
    • p47 phox antibody
    • p47-phox antibody
    • SH3 and PX domain containing protein 1A antibody
    • SH3 and PX domain-containing protein 1A antibody
    • SH3PXD1A antibody
    see all

Images

  • All lanes : Anti-Transglutaminase 2 antibody (ab176463) at 1/1000 dilution

    Lane 1 : Recombinant His-tagged NCF1 protein
    Lane 2 : RAW 264.7 cell lysate

    Developed using the ECL technique.

    Predicted band size: 45 kDa

References

ab176483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up