Overview

  • Product name

  • Description

    Rabbit polyclonal to Nck-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Nck-2 aa 1-380.
    Sequence:

    MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGY VPSNYVERKNSLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYP ANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWR GSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVV QTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKN YVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALN ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFH TMDELVEHYKKAPIFTSEHGEKLYLVRALQ


    Database link: O43639

  • Positive control

    • WB: Mouse brain and kidney tissue lysate. IHC-P: Human breast cancer and skin tissue. ICC/IF: HepG2 cells.
  • General notes

    Protein previously labeled as Nck beta.

Properties

Applications

Our Abpromise guarantee covers the use of ab236913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Adapter protein which associates with tyrosine-phosphorylated growth factor receptors or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 SH2 domain.
    Contains 3 SH3 domains.
  • Cellular localization

    Cytoplasm. Endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytoplasmic protein NCK2 antibody
    • GRB4 antibody
    • Growth factor receptor bound protein 4 antibody
    • NCK adaptor protein 2 antibody
    • Nck-2 antibody
    • NCK2 antibody
    • NCK2_HUMAN antibody
    • NCKbeta antibody
    • Non-catalytic region of tyrosine kinase adaptor protein 2 antibody
    • Noncatalytic region of tyrosine kinase beta antibody
    • SH2/SH3 adaptor protein NCK-beta antibody
    see all

Images

  • All lanes : Anti-Nck-2 antibody (ab236913) at 1/1000 dilution

    Lane 1 : Mouse brain tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human breast cancer tissue stained for Nck-2  using ab236913 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for Nck-2  using ab236913 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Nck-2  (green) using ab236913 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab236913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up