Overview

  • Product name

  • Description

    Rabbit polyclonal to NCM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NCM aa 360-623.
    Sequence:

    VEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKAIKKEILDEG DTDSNTDQDAGSSEEDEEEEEEEGEEDEEGQKVTIHDKTEINLVSFRRTI YLAIQSSLDFEECAHKLLKMEFPESQTKELCNMILDCCAQQRTYEKFFGL LAGRFCMLKKEYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDS LPWSVLECIKLSEETTTSSSRIFVKIFFQELCEYMGLPKLNARLKDETLQ PFFEGLLPRDNPRN


    Database link: Q9HCG8

  • Positive control

    • IHC-P: Human pancreatic cancer tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as CWC22

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234709 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May be involved in pre-mRNA splicing.
  • Sequence similarities

    Belongs to the CWC22 family.
    Contains 1 MI domain.
    Contains 1 MIF4G domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CWC22 antibody
    • CWC22 spliceosome associated protein homolog (S. cerevisiae) antibody
    • CWC22 spliceosome associated protein homolog antibody
    • CWC22_HUMAN antibody
    • EIF4GL antibody
    • fSAPb antibody
    • Functional spliceosome associated protein b antibody
    • KIAA1604 antibody
    • NCM antibody
    • Nucampholin homolog antibody
    • Pre-mRNA-splicing factor CWC22 homolog antibody
    see all

Images

  • Paraffin-embedded human pancreatic cancer tissue stained for NCM using ab234709 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NCM (green) using ab234709 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234709 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234709.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up