Anti-NCOA4 antibody (ab222071)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-NCOA4 antibody
See all NCOA4 primary antibodies -
Description
Rabbit polyclonal to NCOA4 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human NCOA4 aa 524-613.
Sequence:KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSP LQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ
Database link: Q13772 -
Positive control
- ICC/IF: HeLa cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab222071 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Enhances the androgen receptor transcriptional activity in prostate cancer cells. Ligand-independent coactivator of the peroxisome proliferator-activated receptor (PPAR) gamma. -
Tissue specificity
Widely expressed. Also detected in adipose tissues and in different cell lines. Isoform Beta is only expressed in testis. -
Involvement in disease
Defects in NCOA4 are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving NCOA4 is found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q11.2) generates the RET/NCOA4 (PTC3) oncogene that has been found in sporadic and radiation-associated post-Chernobyl thyroid papillary carcinomas. - Information by UniProt
-
Database links
- Entrez Gene: 8031 Human
- Omim: 601984 Human
- SwissProt: Q13772 Human
- Unigene: 643658 Human
- Unigene: 709644 Human
-
Alternative names
- 70 kDa androgen receptor activator antibody
- 70 kDa androgen receptor coactivator antibody
- 70 kDa AR activator antibody
see all
Images
Datasheets and documents
References
ab222071 has not yet been referenced specifically in any publications.