Overview

  • Product name

  • Description

    Rabbit polyclonal to NCOA7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NCOA7 aa 169-232. The aa sequence also shows 100% homology with isoform 2.
    Sequence:

    EEVVSIALYNDISHMKIKDALPSPGEWEDLASEKDINPFSKFKSINKEKR QQNGEKIMTSDSRP


    Database link: Q8NI08-7

  • Positive control

    • IHC-P: Human cervix uterine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    NCOA7, nuclear receptor coactivator 7, enhances the transcriptional activities of several nuclear receptors. It is involved in the coactivation of different nuclear receptors, such as ESR1, THRB, PPARG and RARA.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • 140 kDa estrogen receptor associated protein antibody
    • 9030406N13Rik antibody
    • dJ187J11.3 antibody
    • ERAP140 antibody
    • ESNA1 antibody
    • Estrogen nuclear receptor coactivator 1 antibody
    • FLJ45605 antibody
    • MGC88425 antibody
    • Nbla00052 antibody
    • Nbla10993 antibody
    • Nuclear receptor coactivator 7 antibody
    • RGD1566426 antibody
    see all

Images

  • Paraffin-embedded human cervix uterine tissue stained for NCOA7 using ab224481 at 1/200 dilution in immunohistochemical analysis.

References

ab224481 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up